image-tools3 Tem 2026·2 dk okumaBMP to PNG Guide for Legacy ImagesConvert BMP files to PNG for easier sharing, archiving, editing, documentation, and modern image workflows.legacy-imagesarchivesDevamını Oku BMP to PNG Guide for Legacy Images
calculator3 Tem 2026·3 dk okumaChmod Calculator Practical Workflow GuideUse Chmod Calculator for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.mathplanningproductivityDevamını Oku Chmod Calculator Practical Workflow Guide
image-tools3 Tem 2026·5 dk okumaFavicon Generator Guide for a Cleaner Brand PresenceLearn how to create a crisp favicon system that works across browser tabs, bookmarks, mobile shortcuts, and modern brand touchpoints.brandingweb-designseoDevamını Oku Favicon Generator Guide for a Cleaner Brand Presence
css3 Tem 2026·3 dk okumaCSS Minifier Practical Workflow GuideUse CSS Minifier for front-end design workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designfrontendworkflowDevamını Oku CSS Minifier Practical Workflow Guide
data-formats3 Tem 2026·3 dk okumaJSON YAML Converter Practical Workflow GuideUse JSON YAML Converter for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku JSON YAML Converter Practical Workflow Guide
pdf3 Tem 2026·2 dk okumaPDF Merge Guide for Client PacketsMerge PDFs into clearer client packets, application bundles, onboarding documents, reports, and submission files.client-packetsdocumentsproductivityDevamını Oku PDF Merge Guide for Client Packets
games3 Tem 2026·3 dk okumaAnagram Solver Practical Workflow GuideUse Anagram Solver for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Anagram Solver Practical Workflow Guide
data-formats2 Tem 2026·2 dk okumaJSON Validator Guide for Cleaner DataValidate JSON before imports, API tests, documentation, automation, settings updates, and data handoffs.data-validationapideveloper-toolsDevamını Oku JSON Validator Guide for Cleaner Data
color2 Tem 2026·3 dk okumaHTML Color Codes Guide for CSS ReferenceUnderstand HTML color codes, hex values, RGB, HSL, and named colors so design specs and CSS implementation stay consistent.cssfrontendweb-designDevamını Oku HTML Color Codes Guide for CSS Reference
social-media-images2 Tem 2026·3 dk okumaSocial Media Image Resizer Guide for Platform SizingPrepare social media images for platform-specific sizes, crops, previews, and feeds without losing the message or visual quality.image-toolscontent-marketingdesignDevamını Oku Social Media Image Resizer Guide for Platform Sizing
pdf1 Tem 2026·2 dk okumaPDF to Text Guide for Research ExtractionExtract text from PDFs for research notes, quotes, summaries, archives, accessibility review, and cleaner document workflows.research-workflowdocument-extractionproductivityDevamını Oku PDF to Text Guide for Research Extraction
image-tools1 Tem 2026·3 dk okumaAvatar Generator Practical Workflow GuideUse Avatar Generator for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku Avatar Generator Practical Workflow Guide
encoding1 Tem 2026·3 dk okumaEndianness Swap Practical Workflow GuideUse Endianness Swap for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Endianness Swap Practical Workflow Guide
cron30 Haz 2026·3 dk okumaCron Generator Guide for Safer Job SchedulingCreate, review, and document cron expressions for recurring jobs without missing time zones, frequency limits, or operational risk.schedulingoperationsdeveloper-toolsDevamını Oku Cron Generator Guide for Safer Job Scheduling
pdf30 Haz 2026·3 dk okumaHEIC to PDF Practical Workflow GuideUse HEIC to PDF for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku HEIC to PDF Practical Workflow Guide
writing30 Haz 2026·3 dk okumaPlagiarism Checker Guide: Protect Original Writing Before You PublishUse plagiarism checking responsibly for essays, blog posts, reports, and professional writing while improving originality.educationcontentfree-toolsDevamını Oku Plagiarism Checker Guide: Protect Original Writing Before You Publish
seo30 Haz 2026·2 dk okumaMeta Tag Generator Guide: Write Titles and Descriptions That Earn ClicksLearn practical meta title and description rules for SEO, social previews, landing pages, blog posts, and product pages.metadataweb-developmentgeneratorcontentDevamını Oku Meta Tag Generator Guide: Write Titles and Descriptions That Earn Clicks
writing29 Haz 2026·2 dk okumaCitation Generator Guide for Research WritingCreate cleaner citations for essays, reports, articles, presentations, and research notes while keeping sources organized.sourcesDevamını Oku Citation Generator Guide for Research Writing
image-tools29 Haz 2026·2 dk okumaInfographic Maker Guide for Data StorytellingCreate infographics that turn research, reports, timelines, and comparisons into clear visual stories without oversimplifying the data.data-storytellingdesigncontent-marketingDevamını Oku Infographic Maker Guide for Data Storytelling
timeline-maker29 Haz 2026·3 dk okumaTimeline Maker Guide for Project and History MappingCreate timelines for projects, research, product launches, case studies, and history lessons that make sequence and context easier to follow.project-planningresearchstorytellingDevamını Oku Timeline Maker Guide for Project and History Mapping
pdf28 Haz 2026·3 dk okumaPDF Split Guide for Large File WorkflowsSplit large PDFs into useful sections for review, upload, archiving, redaction, and collaboration without losing context.documentsfile-organizationproductivityDevamını Oku PDF Split Guide for Large File Workflows
data-formats28 Haz 2026·2 dk okumaXML JSON Converter Guide for API MigrationConvert XML and JSON during API migrations, integrations, and data reviews while preserving structure, attributes, arrays, and meaning.apiDevamını Oku XML JSON Converter Guide for API Migration
encoding27 Haz 2026·2 dk okumaURL Encoder Guide for Query StringsEncode URLs and query strings for links, forms, redirects, tracking parameters, search terms, and shared references.data-formatsweb-toolslinksDevamını Oku URL Encoder Guide for Query Strings
data-formats25 Haz 2026·2 dk okumaProperties Converter Guide for Java Config FilesConvert Java properties files into cleaner structured formats while preserving keys, values, escaping, comments, and environment intent.java-configconfigurationmigrationDevamını Oku Properties Converter Guide for Java Config Files
encoding25 Haz 2026·3 dk okumaDeflate Raw Decompress Practical Workflow GuideUse Deflate Raw Decompress for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Deflate Raw Decompress Practical Workflow Guide
pdf25 Haz 2026·3 dk okumaJPG to PDF Practical Workflow GuideUse JPG to PDF for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku JPG to PDF Practical Workflow Guide
encoding25 Haz 2026·2 dk okumaImage to Base64 Guide for Web AssetsUnderstand when to convert images to Base64 for small web assets, prototypes, emails, documentation, and data URIs.web-assetsdata-formatsdeveloper-toolsDevamını Oku Image to Base64 Guide for Web Assets
image-tools25 Haz 2026·3 dk okumaBMP to JPG Practical Workflow GuideUse BMP to JPG for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku BMP to JPG Practical Workflow Guide
image-tools25 Haz 2026·2 dk okumaPhoto to Cartoon Guide for Social AvatarsConvert photos into cartoon-style avatars and campaign assets while keeping identity, tone, and platform use clear.social-mediacreative-assetsDevamını Oku Photo to Cartoon Guide for Social Avatars
business24 Haz 2026·2 dk okumaBusiness Name Generator Guide: Find Names That Are Clear and UsableUse business name generators wisely, then check clarity, domain fit, pronunciation, trademarks, audience, and long-term brand use.brandinggeneratorstartupmarketingDevamını Oku Business Name Generator Guide: Find Names That Are Clear and Usable
cron-next-runs24 Haz 2026·3 dk okumaCron Next Runs Practical Workflow GuideUse Cron Next Runs for time planning workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.time-toolsplanningproductivityschedulingDevamını Oku Cron Next Runs Practical Workflow Guide
pdf23 Haz 2026·4 dk okumaPDF Redaction Checklist: How to Remove Sensitive Information SafelyLearn how to redact PDFs safely, avoid common privacy mistakes, and verify that sensitive information is actually removed.privacysecuritydocumentsfree-toolsDevamını Oku PDF Redaction Checklist: How to Remove Sensitive Information Safely
encoding23 Haz 2026·3 dk okumaNATO Alphabet Practical Workflow GuideUse NATO Alphabet for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku NATO Alphabet Practical Workflow Guide
generator23 Haz 2026·2 dk okumaBaby Name Generator Guide for Family ShortlistsUse a baby name generator to build thoughtful shortlists by sound, meaning, initials, family context, and long-term usability.baby-namesfamily-planningDevamını Oku Baby Name Generator Guide for Family Shortlists
css23 Haz 2026·3 dk okumaBox Shadow Generator Practical Workflow GuideUse Box Shadow Generator for front-end design workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designfrontendworkflowDevamını Oku Box Shadow Generator Practical Workflow Guide
text-tools23 Haz 2026·2 dk okumaTyping Speed Test Guide: Improve WPM Without Losing AccuracyUse typing speed tests to improve WPM, accuracy, rhythm, ergonomics, and daily practice without building bad habits.productivitytextpracticefree-toolsDevamını Oku Typing Speed Test Guide: Improve WPM Without Losing Accuracy
data-formats23 Haz 2026·5 dk okumaJSON Schema Validation for API Teams: Catch Payload Bugs Before ProductionA practical guide to JSON Schema validation for API teams, with examples, workflows, and common mistakes to avoid.apideveloper-toolsschematestingDevamını Oku JSON Schema Validation for API Teams: Catch Payload Bugs Before Production
calculator23 Haz 2026·2 dk okumaVolume Calculator Guide for Containers and ProjectsCalculate volume for containers, boxes, rooms, tanks, garden beds, packaging, and classroom problems with clearer measurements.measurementcontainersproject-planningDevamını Oku Volume Calculator Guide for Containers and Projects
seo22 Haz 2026·3 dk okumaOpen Graph Preview Guide: Make Shared Links Look TrustworthyLearn how Open Graph previews work, what metadata matters, and how to fix bad social sharing cards before publishing.social-mediametadataweb-developmentdeveloper-toolsDevamını Oku Open Graph Preview Guide: Make Shared Links Look Trustworthy
image-tools22 Haz 2026·2 dk okumaAVIF to JPG Guide for Photo SharingConvert AVIF images to JPG for easier sharing, uploads, previews, printing workflows, and compatibility with older platforms.compatibilityDevamını Oku AVIF to JPG Guide for Photo Sharing
email22 Haz 2026·2 dk okumaEmail Validator Checklist: Catch Bad Addresses Before They BounceUse email validation to reduce typos, bounced messages, form errors, and list quality problems without overblocking users.validationmarketingdeveloper-toolsformsDevamını Oku Email Validator Checklist: Catch Bad Addresses Before They Bounce
text-tools22 Haz 2026·3 dk okumaLine Reverse Practical Workflow GuideUse Line Reverse for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.writingeditingproductivityDevamını Oku Line Reverse Practical Workflow Guide
writing22 Haz 2026·3 dk okumaText Summarizer Guide for Faster Research WorkflowsUse text summarization to triage articles, reports, transcripts, and notes while preserving source context and avoiding shallow conclusions.researchproductivityDevamını Oku Text Summarizer Guide for Faster Research Workflows
data-formats21 Haz 2026·3 dk okumaJSON Deep Diff Practical Workflow GuideUse JSON Deep Diff for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku JSON Deep Diff Practical Workflow Guide
encoding20 Haz 2026·3 dk okumaBase58 Encode Practical Workflow GuideUse Base58 Encode for converter workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.converterworkflowproductivityonline-toolsDevamını Oku Base58 Encode Practical Workflow Guide
writing20 Haz 2026·3 dk okumaCitation Generator Guide for Cleaner Academic WritingUse a citation generator to organize sources, reduce formatting errors, and keep academic or research writing easier to verify.researchDevamını Oku Citation Generator Guide for Cleaner Academic Writing
date-formatter20 Haz 2026·3 dk okumaDate Formatter Practical Workflow GuideUse Date Formatter for time planning workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.time-toolsplanningproductivityschedulingDevamını Oku Date Formatter Practical Workflow Guide
calculator19 Haz 2026·3 dk okumaPercentage Calculator Guide for Everyday Business MathUse percentage calculations for pricing, growth, discounts, margins, reports, and comparisons without making spreadsheet mistakes.business-mathproductivityDevamını Oku Percentage Calculator Guide for Everyday Business Math
video19 Haz 2026·2 dk okumaVideo Speed Changer Guide for Review WorkflowsChange video speed for review, training, tutorials, demonstrations, and social edits while protecting comprehension and audio quality.trainingcontent-creationDevamını Oku Video Speed Changer Guide for Review Workflows
text19 Haz 2026·2 dk okumaLorem Ipsum Generator Guide: Use Placeholder Text Without Hiding UX ProblemsUse lorem ipsum and placeholder text responsibly in wireframes, mockups, prototypes, and content-heavy interfaces.designcontentgeneratoruxDevamını Oku Lorem Ipsum Generator Guide: Use Placeholder Text Without Hiding UX Problems
encoding19 Haz 2026·3 dk okumaDeflate Raw Compress Practical Workflow GuideUse Deflate Raw Compress for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Deflate Raw Compress Practical Workflow Guide
image-tools18 Haz 2026·3 dk okumaColor Palette Generator Guide for Brand SystemsCreate practical color palettes for brands, products, dashboards, and campaigns by balancing identity, contrast, roles, and reuse.brandingdesign-systemsweb-designDevamını Oku Color Palette Generator Guide for Brand Systems
encoding18 Haz 2026·3 dk okumaHex Dump Practical Workflow GuideUse Hex Dump for safe inspection workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsinspectionprivacyworkflowDevamını Oku Hex Dump Practical Workflow Guide
data-formats18 Haz 2026·2 dk okumaCSV Advanced Guide for Spreadsheet CleanupClean CSV files for imports, reports, lists, product data, research exports, and spreadsheet workflows with fewer surprises.spreadsheet-cleanupdata-cleanupproductivityDevamını Oku CSV Advanced Guide for Spreadsheet Cleanup
markdown17 Haz 2026·4 dk okumaMarkdown to HTML Workflow: Publish Cleaner Content With Fewer SurprisesA practical Markdown to HTML workflow for blogs, docs, newsletters, and static sites, with formatting and safety checks.htmlwritingdeveloper-toolscontentDevamını Oku Markdown to HTML Workflow: Publish Cleaner Content With Fewer Surprises
text-tools17 Haz 2026·2 dk okumaASCII Art Generator Guide for Retro DesignCreate cleaner ASCII art for profiles, READMEs, chat posts, banners, teaching examples, and retro-inspired visuals.retro-designcreative-toolsDevamını Oku ASCII Art Generator Guide for Retro Design
video17 Haz 2026·2 dk okumaVideo Thumbnail Maker Guide for Clickable PreviewsCreate clearer video thumbnails for tutorials, social clips, product demos, and courses with stronger framing, text, and visual hierarchy.content-creationsocial-mediadesignDevamını Oku Video Thumbnail Maker Guide for Clickable Previews
image-tools17 Haz 2026·2 dk okumaPhoto to Sketch Guide for Creative AssetsTurn photos into sketch-style assets for mood boards, social posts, teaching material, and design exploration with better source prep.creative-assetsdesign-workflowDevamını Oku Photo to Sketch Guide for Creative Assets
web-development17 Haz 2026·3 dk okumaWebsite Screenshot Workflow: QA Pages Before Users Find the BugsUse website screenshots for QA, visual review, client approvals, regression checks, and content audits across devices.qadesignimage-toolsdeveloper-toolsDevamını Oku Website Screenshot Workflow: QA Pages Before Users Find the Bugs
markdown17 Haz 2026·3 dk okumaMarkdown Preview Guide for Cleaner DocumentationUse Markdown preview workflows to catch structure, formatting, links, tables, and readability issues before documentation is published.documentationwritingdeveloper-toolsDevamını Oku Markdown Preview Guide for Cleaner Documentation
pdf16 Haz 2026·3 dk okumaPDF Annotation Extractor Practical Workflow GuideUse PDF Annotation Extractor for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Annotation Extractor Practical Workflow Guide
magic-bytes-detector16 Haz 2026·3 dk okumaMagic Bytes Detector Practical Workflow GuideUse Magic Bytes Detector for safe inspection workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsinspectionprivacyworkflowDevamını Oku Magic Bytes Detector Practical Workflow Guide
data-formats16 Haz 2026·2 dk okumaCSV to XML Guide for Data ExchangeConvert CSV files into XML for feeds, legacy systems, vendor handoffs, and structured imports with clearer tags and cleaner rows.data-exchangelegacy-systemsconverterDevamını Oku CSV to XML Guide for Data Exchange
networking16 Haz 2026·3 dk okumaMac Address Formatter Practical Workflow GuideUse Mac Address Formatter for network debugging workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsdebuggingprivacyDevamını Oku Mac Address Formatter Practical Workflow Guide
digital-safety-score15 Haz 2026·3 dk okumaDigital Safety Score Practical Workflow GuideUse Digital Safety Score for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Digital Safety Score Practical Workflow Guide
text-tools15 Haz 2026·2 dk okumaMarkdown Stripper Guide for Plain Text WorkflowsStrip Markdown formatting from drafts, docs, notes, and generated content when plain text is needed for email, forms, scripts, or review.documentationwritingDevamını Oku Markdown Stripper Guide for Plain Text Workflows
pdf15 Haz 2026·3 dk okumaPDF Header Footer Practical Workflow GuideUse PDF Header Footer for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Header Footer Practical Workflow Guide
resume15 Haz 2026·4 dk okumaResume Builder Guide: Create an ATS-Friendly Resume That Still Reads WellBuild an ATS-friendly resume with better structure, keywords, formatting, accomplishments, and practical editing rules.careerwritinggeneratorproductivityDevamını Oku Resume Builder Guide: Create an ATS-Friendly Resume That Still Reads Well
generator15 Haz 2026·3 dk okumaJWT Generator Practical Workflow GuideUse JWT Generator for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku JWT Generator Practical Workflow Guide
css15 Haz 2026·3 dk okumaBorder Radius Generator Practical Workflow GuideUse Border Radius Generator for front-end design workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designfrontendworkflowDevamını Oku Border Radius Generator Practical Workflow Guide
generator13 Haz 2026·2 dk okumaBusiness Name Generator Guide for Startup NamingUse a business name generator to explore stronger startup, product, side project, shop, and service brand name ideas.startup-namingbrandingentrepreneurshipDevamını Oku Business Name Generator Guide for Startup Naming
to-do-list13 Haz 2026·3 dk okumaTo-Do List Prioritization Guide for Less Overwhelming DaysTurn a crowded to-do list into a practical daily plan with prioritization rules, realistic sizing, energy matching, and follow-through habits.productivityplanningfocusDevamını Oku To-Do List Prioritization Guide for Less Overwhelming Days
gantt-charts12 Haz 2026·4 dk okumaGantt Chart Maker Guide for Practical Project PlanningPlan projects with Gantt charts that clarify timelines, dependencies, owners, milestones, and delivery risks without overwhelming the team.project-planningproductivityoperationsDevamını Oku Gantt Chart Maker Guide for Practical Project Planning
pdf12 Haz 2026·3 dk okumaPDF Unlock Guide for Authorized Password WorkflowsHandle password-protected PDFs responsibly when you own the file, know the password, and need an easier review or editing workflow.documentssecurityDevamını Oku PDF Unlock Guide for Authorized Password Workflows
calculator12 Haz 2026·3 dk okumaMultiplication Table Practical Workflow GuideUse Multiplication Table for learning worksheet workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.educationmathgeneratorproductivityDevamını Oku Multiplication Table Practical Workflow Guide
ieee754-inspector12 Haz 2026·3 dk okumaIEEE 754 Inspector Practical Workflow GuideUse IEEE 754 Inspector for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku IEEE 754 Inspector Practical Workflow Guide
pdf12 Haz 2026·3 dk okumaPDF Redact Practical Workflow GuideUse PDF Redact for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Redact Practical Workflow Guide
encoding12 Haz 2026·3 dk okumaChecksum Verifier Guide for Safer DownloadsVerify downloaded files with checksums so installers, archives, releases, and data exports match the expected source.downloadsfile-integritysecurityDevamını Oku Checksum Verifier Guide for Safer Downloads
image-tools11 Haz 2026·3 dk okumaRemove Image Backgrounds for Product Photos: Cleaner Listings FastLearn how to remove backgrounds from product photos, prepare clean ecommerce images, and avoid common editing mistakes.ecommercedesignfree-toolsDevamını Oku Remove Image Backgrounds for Product Photos: Cleaner Listings Fast
css11 Haz 2026·3 dk okumaCSS Animation Generator Guide for MicrointeractionsCreate small CSS animations for feedback, loading, emphasis, and transitions while keeping performance, accessibility, and restraint in mind.frontendinteraction-designaccessibilityDevamını Oku CSS Animation Generator Guide for Microinteractions
word-clouds9 Haz 2026·3 dk okumaWord Cloud Generator Guide for Quick Research InsightsUse word clouds to explore survey responses, reviews, transcripts, and notes while avoiding misleading conclusions from raw frequency.researchvisualizationtext-toolsDevamını Oku Word Cloud Generator Guide for Quick Research Insights
text-tools9 Haz 2026·2 dk okumaText Replacer Guide for Bulk EditingUse find-and-replace workflows to update repeated text, names, URLs, formatting, and templates without creating accidental changes.bulk-editingcontent-cleanupproductivityDevamını Oku Text Replacer Guide for Bulk Editing
text-tools9 Haz 2026·3 dk okumaLine Dedup Practical Workflow GuideUse Line Dedup for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.writingeditingproductivityDevamını Oku Line Dedup Practical Workflow Guide
image-tools9 Haz 2026·3 dk okumaImage Resizer Guide for Social Platforms and WebsitesResize images for social posts, websites, thumbnails, ads, and email without losing clarity, cropping important details, or slowing pages.social-mediaweb-performancedesignDevamını Oku Image Resizer Guide for Social Platforms and Websites
pdf8 Haz 2026·3 dk okumaPDF Watermark Guide for Branding and Draft ControlAdd PDF watermarks for drafts, internal review, client previews, ownership labels, and document status without damaging readability.documentsbrandingreview-workflowDevamını Oku PDF Watermark Guide for Branding and Draft Control
encoding8 Haz 2026·3 dk okumaBraille Converter Practical Workflow GuideUse Braille Converter for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Braille Converter Practical Workflow Guide
image-tools8 Haz 2026·2 dk okumaGIF to WebP Guide for Animation OptimizationConvert GIF animations to WebP for lighter web assets, smoother previews, documentation, social snippets, and product demos.animationweb-performanceDevamını Oku GIF to WebP Guide for Animation Optimization
calculator8 Haz 2026·2 dk okumaArea Calculator Guide for Room and Project PlanningCalculate area more reliably for rooms, walls, gardens, flooring, painting, layouts, and material planning.home-projectsmeasurementplanningDevamını Oku Area Calculator Guide for Room and Project Planning
pdf8 Haz 2026·3 dk okumaPDF to Excel Guide for Cleaner Data ExtractionConvert PDF tables into Excel-ready data with fewer cleanup problems by preparing pages, checking columns, and validating totals.spreadsheetsdata-extractionproductivityDevamını Oku PDF to Excel Guide for Cleaner Data Extraction
social-media-bio8 Haz 2026·2 dk okumaSocial Media Bio Generator Guide for Profile OptimizationWrite clearer social media bios for creators, founders, brands, and local businesses with stronger positioning and calls to action.profile-optimizationpersonal-brandmarketingDevamını Oku Social Media Bio Generator Guide for Profile Optimization
fuel-cost8 Haz 2026·3 dk okumaFuel Cost Calculator Guide for Trip BudgetsEstimate trip fuel costs with distance, efficiency, fuel price, route changes, and shared expenses so travel budgets feel less vague.travel-planningbudgetingcalculatorDevamını Oku Fuel Cost Calculator Guide for Trip Budgets
converter8 Haz 2026·2 dk okumaSpeed Converter Guide for Travel and CommutesConvert speed units for travel, commuting, cycling, shipping, classrooms, and route planning with clearer context.travelcommutingmeasurementDevamını Oku Speed Converter Guide for Travel and Commutes
pdf7 Haz 2026·2 dk okumaPowerPoint to PDF Guide for Presentation SharingConvert presentations to PDFs for client review, classroom handouts, event packets, archives, and stable slide sharing.presentation-sharingslide-decksproductivityDevamını Oku PowerPoint to PDF Guide for Presentation Sharing
ai6 Haz 2026·2 dk okumaAI Translator Guide for Multilingual ContentUse AI translation for articles, product copy, support drafts, captions, and localization with better review habits.localizationmultilingual-contentcontent-workflowDevamını Oku AI Translator Guide for Multilingual Content
pdf6 Haz 2026·3 dk okumaBMP to PDF Practical Workflow GuideUse BMP to PDF for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku BMP to PDF Practical Workflow Guide
image-tools5 Haz 2026·2 dk okumaPNG to JPG Guide for Smaller Photo FilesConvert PNG images to JPG when photos, previews, uploads, and attachments need smaller files without unnecessary transparency.file-sharingDevamını Oku PNG to JPG Guide for Smaller Photo Files
age-from-date5 Haz 2026·3 dk okumaAge From Date Practical Workflow GuideUse Age From Date for time planning workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.time-toolsplanningproductivityschedulingDevamını Oku Age From Date Practical Workflow Guide
data-formats5 Haz 2026·3 dk okumaCSV Diff Practical Workflow GuideUse CSV Diff for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku CSV Diff Practical Workflow Guide
color5 Haz 2026·3 dk okumaColor Shades Generator Guide for Design TokensGenerate color shade scales for design tokens, hover states, surfaces, charts, and themes without creating inconsistent one-off values.design-tokensui-designfrontendDevamını Oku Color Shades Generator Guide for Design Tokens
encoding5 Haz 2026·3 dk okumaBitwise Operation Practical Workflow GuideUse Bitwise Operation for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Bitwise Operation Practical Workflow Guide
pdf5 Haz 2026·3 dk okumaPDF Chat Practical Workflow GuideUse PDF Chat for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Chat Practical Workflow Guide
encoding5 Haz 2026·3 dk okumaAES Encrypt Practical Workflow GuideUse AES Encrypt for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku AES Encrypt Practical Workflow Guide
pdf4 Haz 2026·3 dk okumaPDF Text Diff Practical Workflow GuideUse PDF Text Diff for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Text Diff Practical Workflow Guide
iso-duration-parser4 Haz 2026·3 dk okumaIso Duration Parser Practical Workflow GuideUse Iso Duration Parser for time planning workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.time-toolsplanningproductivityschedulingDevamını Oku Iso Duration Parser Practical Workflow Guide
data-formats4 Haz 2026·3 dk okumaJSON Validator Guide for Error DebuggingFind and fix JSON syntax errors in API payloads, configuration files, fixtures, and logs with a more systematic validation workflow.debuggingdeveloper-toolsapiDevamını Oku JSON Validator Guide for Error Debugging
generator4 Haz 2026·2 dk okumaUsername Generator Guide for Profile IdentityCreate better username ideas for social profiles, creator brands, communities, games, side projects, and professional accounts.profile-identitysocial-mediabrandingDevamını Oku Username Generator Guide for Profile Identity
image-tools4 Haz 2026·2 dk okumaThumbnail Maker Guide for Social PreviewsDesign stronger thumbnails for posts, videos, products, articles, and resources with clearer framing, contrast, and message hierarchy.social-previewscontent-designvisual-hierarchyDevamını Oku Thumbnail Maker Guide for Social Previews
quote-maker3 Haz 2026·3 dk okumaQuote Maker Guide for Shareable Social PostsCreate cleaner quote graphics for social media, newsletters, classrooms, communities, and campaigns with better typography and context.social-mediatypographycontent-designDevamını Oku Quote Maker Guide for Shareable Social Posts
ai3 Haz 2026·2 dk okumaAI Face Swap Guide for Photo Editing EthicsUse AI face swap tools responsibly for creative edits, private projects, consent-based images, and clear disclosure.image-toolsconsentcreative-workflowDevamını Oku AI Face Swap Guide for Photo Editing Ethics
generator3 Haz 2026·2 dk okumaInvoice Generator Guide for Freelance BillingCreate clearer invoices for freelance work, services, retainers, deposits, and project billing with better detail and review habits.freelance-billingsmall-businessproductivityDevamını Oku Invoice Generator Guide for Freelance Billing
generator3 Haz 2026·3 dk okumaPoem Generator Practical Workflow GuideUse Poem Generator for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Poem Generator Practical Workflow Guide
networking3 Haz 2026·4 dk okumaDNS Lookup Troubleshooting: Find Domain Problems FasterA practical DNS lookup troubleshooting guide for broken websites, email issues, propagation delays, and misconfigured records.developer-toolsweb-developmenttroubleshootingDevamını Oku DNS Lookup Troubleshooting: Find Domain Problems Faster
games3 Haz 2026·3 dk okumaSpin The Wheel Practical Workflow GuideUse Spin The Wheel for creation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.generatorcreative-workflowproductivityplanningDevamını Oku Spin The Wheel Practical Workflow Guide
pdf3 Haz 2026·2 dk okumaPDF Editor Guide for Revision WorkflowsUse a PDF editor for small corrections, annotations, review marks, form updates, page cleanup, and final document checks.document-revisionannotationsproductivityDevamını Oku PDF Editor Guide for Revision Workflows
networking2 Haz 2026·3 dk okumaHTTP Status Codes Practical Workflow GuideUse HTTP Status Codes for network debugging workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsdebuggingprivacyDevamını Oku HTTP Status Codes Practical Workflow Guide
calculator2 Haz 2026·3 dk okumaFraction Calculator Practical Workflow GuideUse Fraction Calculator for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.mathplanningproductivityDevamını Oku Fraction Calculator Practical Workflow Guide
networking2 Haz 2026·3 dk okumaHTTP Header Parser Guide for Web DebuggingInspect HTTP headers to debug caching, redirects, content types, security policies, cookies, APIs, and performance issues.web-debuggingperformancedeveloper-toolsDevamını Oku HTTP Header Parser Guide for Web Debugging
games2 Haz 2026·3 dk okumaTetris Strategy Guide: Clear More Lines and Survive LongerLearn practical Tetris strategies for stacking, wells, holds, previews, recovery, and improving your score over time.strategybrainDevamını Oku Tetris Strategy Guide: Clear More Lines and Survive Longer
sql2 Haz 2026·3 dk okumaSQL Formatter Guide: Review Queries Without Getting LostUse SQL formatting to review complex queries, debug joins, understand filters, and make database work safer.databasedeveloper-toolsdebuggingprogrammingDevamını Oku SQL Formatter Guide: Review Queries Without Getting Lost
image-tools2 Haz 2026·4 dk okumaWebP vs JPG vs PNG: Which Image Format Should You Use?Compare WebP, JPG, and PNG for photos, screenshots, transparency, SEO, file size, and web performance.webpperformanceseoconverterDevamını Oku WebP vs JPG vs PNG: Which Image Format Should You Use?
encoding2 Haz 2026·3 dk okumaPBKDF2 Derive Practical Workflow GuideUse PBKDF2 Derive for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku PBKDF2 Derive Practical Workflow Guide
generator31 May 2026·3 dk okumaCalendar Generator Guide for Content PlanningBuild practical content calendars for publishing, campaigns, classes, events, and internal workflows without losing deadlines or owners.content-planningproductivitymarketingDevamını Oku Calendar Generator Guide for Content Planning
converter31 May 2026·2 dk okumaTemperature Converter Guide for Cooking and TravelConvert Celsius, Fahrenheit, and Kelvin more confidently for recipes, travel, classrooms, weather, and basic science work.cookingtravelmeasurementDevamını Oku Temperature Converter Guide for Cooking and Travel
networking30 May 2026·3 dk okumaURL Shortener Guide for Safer Link SharingUse short links for campaigns, print materials, social posts, and support messages without losing trust, context, or tracking discipline.link-sharingmarketinganalyticsDevamını Oku URL Shortener Guide for Safer Link Sharing
networking30 May 2026·2 dk okumaWiFi QR Generator Guide for Guest NetworksCreate WiFi QR codes for offices, cafes, rentals, events, and homes so guests can connect without typing long network passwords.qr-codesoperationsDevamını Oku WiFi QR Generator Guide for Guest Networks
video30 May 2026·2 dk okumaSubtitle Generator Guide for Accessible VideoGenerate and review subtitles for tutorials, social videos, courses, meetings, and demos so more people can follow the content.accessibilitycaptionsDevamını Oku Subtitle Generator Guide for Accessible Video
encoding28 May 2026·3 dk okumaHex Encoder Practical Workflow GuideUse Hex Encoder for converter workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.converterworkflowproductivityonline-toolsDevamını Oku Hex Encoder Practical Workflow Guide
ai28 May 2026·2 dk okumaAI Logo Maker Guide for Startup IdentityUse an AI logo maker to explore startup logo directions, brand concepts, color ideas, and early visual identity systems.startup-brandinglogo-designvisual-identityDevamını Oku AI Logo Maker Guide for Startup Identity
color27 May 2026·2 dk okumaColor Palette Generator Guide: Build Better Brand and UI PalettesCreate practical color palettes for websites, brands, dashboards, and content without sacrificing contrast or usability.designaccessibilitygeneratorweb-developmentDevamını Oku Color Palette Generator Guide: Build Better Brand and UI Palettes
encoding27 May 2026·3 dk okumaDeflate Compress Practical Workflow GuideUse Deflate Compress for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Deflate Compress Practical Workflow Guide
css27 May 2026·3 dk okumaCSS Clip Path Generator Practical Workflow GuideUse CSS Clip Path Generator for front-end design workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designfrontendworkflowDevamını Oku CSS Clip Path Generator Practical Workflow Guide
encoding27 May 2026·3 dk okumaBase64 to Image Info Practical Workflow GuideUse Base64 to Image Info for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.image-toolsdesignworkflowmediaDevamını Oku Base64 to Image Info Practical Workflow Guide
image-tools27 May 2026·2 dk okumaPlaceholder Image Generator Guide for MockupsUse placeholder images in wireframes, templates, prototypes, cards, galleries, and design systems without hiding layout problems.mockupsdesign-workflowprototypesDevamını Oku Placeholder Image Generator Guide for Mockups
converter27 May 2026·3 dk okumaNumber Base Converter Practical Workflow GuideUse Number Base Converter for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.calculatormathplanningproductivityDevamını Oku Number Base Converter Practical Workflow Guide
encoding27 May 2026·3 dk okumaAES Decrypt Practical Workflow GuideUse AES Decrypt for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku AES Decrypt Practical Workflow Guide
electricity-cost26 May 2026·3 dk okumaElectricity Cost Calculator Guide for Appliance UsageEstimate appliance electricity costs using wattage, usage time, and local rates so energy decisions become easier to compare.energy-usehome-budgetingcalculatorDevamını Oku Electricity Cost Calculator Guide for Appliance Usage
text-tools26 May 2026·2 dk okumaCase Converter Guide for Data CleanupUse case conversion to clean names, headings, slugs, code identifiers, CSV columns, and imported text without manual retyping.data-cleanupproductivityDevamını Oku Case Converter Guide for Data Cleanup
image-tools26 May 2026·3 dk okumaHEIC to PNG Practical Workflow GuideUse HEIC to PNG for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku HEIC to PNG Practical Workflow Guide
pdf25 May 2026·3 dk okumaPDF Flatten Practical Workflow GuideUse PDF Flatten for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Flatten Practical Workflow Guide
encoding25 May 2026·3 dk okumaProtobuf Decoder Practical Workflow GuideUse Protobuf Decoder for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku Protobuf Decoder Practical Workflow Guide
encoding25 May 2026·3 dk okumaHKDF Derive Practical Workflow GuideUse HKDF Derive for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku HKDF Derive Practical Workflow Guide
invitation-maker25 May 2026·3 dk okumaInvitation Maker Guide for Better Event PlanningDesign clearer invitations for parties, workshops, launches, weddings, and community events with stronger details and tone.event-planningdesigncommunicationDevamını Oku Invitation Maker Guide for Better Event Planning
image-tools25 May 2026·3 dk okumaColor Palette Extractor Guide for Photo InspirationExtract color palettes from photos for campaigns, websites, presentations, and mood boards while keeping the final palette practical.designbrandingDevamını Oku Color Palette Extractor Guide for Photo Inspiration
image-tools25 May 2026·3 dk okumaPhoto Filter Editor Practical Workflow GuideUse Photo Filter Editor for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku Photo Filter Editor Practical Workflow Guide
image-tools24 May 2026·3 dk okumaImage Cropper Guide for Cleaner Visual CompositionCrop images for websites, social posts, product pages, and documents while preserving the subject, context, and visual balance.designsocial-mediavisual-contentDevamını Oku Image Cropper Guide for Cleaner Visual Composition
calculator23 May 2026·2 dk okumaCompound Interest Calculator Guide: See How Savings Grow Over TimeUnderstand compound interest, contribution habits, time horizon, growth assumptions, and savings planning with practical examples.financesavingsplanninginvestmentDevamını Oku Compound Interest Calculator Guide: See How Savings Grow Over Time
encoding23 May 2026·4 dk okumaURL Encoder Guide for Query String DebuggingDebug broken links, API requests, redirects, and query strings by understanding when URL encoding is required and how to inspect it.data-formatsdebuggingdeveloper-toolsDevamını Oku URL Encoder Guide for Query String Debugging
timestamps23 May 2026·4 dk okumaTimestamp Converter Guide for Faster Log DebuggingConvert Unix timestamps, compare time zones, and debug logs more reliably when incidents, APIs, and databases disagree about time.debuggingdeveloper-toolslogsDevamını Oku Timestamp Converter Guide for Faster Log Debugging
jwt22 May 2026·3 dk okumaJWT Decoder Guide for Authentication DebuggingInspect JWT headers and payloads safely while debugging login issues, token expiration, permissions, audiences, and environment mismatches.authenticationdebuggingdeveloper-toolsDevamını Oku JWT Decoder Guide for Authentication Debugging
networking22 May 2026·3 dk okumaDNS Propagation Checker Guide for Domain LaunchesCheck DNS propagation during domain launches, migrations, email setup, and hosting changes without guessing from one local result.launch-checklistDevamını Oku DNS Propagation Checker Guide for Domain Launches
games22 May 2026·3 dk okumaCrossword Solver Practical Workflow GuideUse Crossword Solver for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Crossword Solver Practical Workflow Guide
encoding21 May 2026·3 dk okumaHex to Bytes Practical Workflow GuideUse Hex to Bytes for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Hex to Bytes Practical Workflow Guide
data-formats21 May 2026·2 dk okumaCSV to JSON Guide for Import WorkflowsConvert CSV into JSON for application imports, APIs, migrations, and automation while checking headers, types, and missing values.importsdata-migrationdeveloper-toolsDevamını Oku CSV to JSON Guide for Import Workflows
image-tools21 May 2026·3 dk okumaImage Compressor Practical Workflow GuideUse Image Compressor for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku Image Compressor Practical Workflow Guide
encoding21 May 2026·3 dk okumaExtract Hashes Practical Workflow GuideUse Extract Hashes for safe inspection workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsinspectionprivacyworkflowDevamını Oku Extract Hashes Practical Workflow Guide
video21 May 2026·2 dk okumaVideo to MP3 Guide for Audio ExtractionExtract audio from videos for notes, podcasts, interviews, lessons, and review workflows while respecting rights and quality needs.audiomedia-workflowcontent-creationDevamını Oku Video to MP3 Guide for Audio Extraction
data-formats21 May 2026·2 dk okumaXML Formatter Guide: Read, Debug, and Share XML Without the Wall of TextUse XML formatting to inspect feeds, configs, SOAP responses, SVG, sitemaps, and structured documents more clearly.developer-toolsformattingdebuggingweb-developmentDevamını Oku XML Formatter Guide: Read, Debug, and Share XML Without the Wall of Text
jwt19 May 2026·4 dk okumaJWT Decoder Guide: Debug Tokens Without Creating Security RisksLearn how JWT decoding works, what token claims mean, and how to debug authentication issues without leaking secrets.securityapiauthenticationdeveloper-toolsDevamını Oku JWT Decoder Guide: Debug Tokens Without Creating Security Risks
pdf19 May 2026·3 dk okumaPDF Merge Guide for Cleaner Document AssemblyMerge PDFs into polished packets, reports, applications, and client deliverables without losing order, bookmarks, naming, or review control.documentsproductivityfile-organizationDevamını Oku PDF Merge Guide for Cleaner Document Assembly
bytes-to-hex18 May 2026·3 dk okumaBytes to Hex Practical Workflow GuideUse Bytes to Hex for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Bytes to Hex Practical Workflow Guide
resume18 May 2026·3 dk okumaResume Builder Guide for Stronger Job ApplicationsUse a resume builder to create focused applications with clearer achievements, better structure, and fewer formatting distractions.careersjob-searchwritingDevamını Oku Resume Builder Guide for Stronger Job Applications
pdf18 May 2026·3 dk okumaPDF Background Practical Workflow GuideUse PDF Background for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Background Practical Workflow Guide
video18 May 2026·3 dk okumaVideo Compressor Guide for Easier Sharing and UploadsCompress videos for email, social media, websites, product demos, and team sharing while protecting clarity and avoiding oversized files.sharingcontent-creationDevamını Oku Video Compressor Guide for Easier Sharing and Uploads
tools18 May 2026·15 dk okumaBest Free Project Management Tools 2026 — Kanban, Gantt & Task TrackingManage projects for free with the best online task trackers, kanban boards, and Gantt chart tools. Compare features, limits, and which is best for your team size.productivitycollaborationDevamını Oku Best Free Project Management Tools 2026 — Kanban, Gantt & Task Tracking
encoding18 May 2026·3 dk okumaBencode Converter Practical Workflow GuideUse Bencode Converter for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku Bencode Converter Practical Workflow Guide
data-formats17 May 2026·2 dk okumaYAML Validator Guide: Catch Config Errors Before DeployUse YAML validation to catch indentation, quoting, boolean, list, and configuration mistakes before they break builds or deploys.devopsdeveloper-toolsconfigurationvalidationDevamını Oku YAML Validator Guide: Catch Config Errors Before Deploy
world-clock16 May 2026·3 dk okumaWorld Clock Practical Workflow GuideUse World Clock for time planning workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.time-toolsplanningproductivityschedulingDevamını Oku World Clock Practical Workflow Guide
email-validation16 May 2026·3 dk okumaEmail Validator Guide for Cleaner Contact ListsValidate email addresses before imports, campaigns, forms, and CRM updates so lists stay cleaner and user-facing errors drop.crmdata-cleanupmarketingDevamını Oku Email Validator Guide for Cleaner Contact Lists
unicode16 May 2026·2 dk okumaUnicode Converter Guide for Text DebuggingUse Unicode conversion to inspect characters, code points, symbols, encoding issues, invisible characters, and multilingual text problems.text-toolsencodingdeveloper-toolsDevamını Oku Unicode Converter Guide for Text Debugging
regex15 May 2026·8 dk okumaRegex Cheat Sheet 2026 — Regular Expressions Made SimpleThe ultimate regex cheat sheet with examples for email validation, URL matching, phone numbers, and more. Test your patterns with our free online regex tester.developer-toolsprogrammingjavascriptweb-developmentDevamını Oku Regex Cheat Sheet 2026 — Regular Expressions Made Simple
encoding15 May 2026·3 dk okumaEntropy Calculator Practical Workflow GuideUse Entropy Calculator for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku Entropy Calculator Practical Workflow Guide
pdf15 May 2026·3 dk okumaWord to PDF Guide for Final Document DeliveryConvert Word documents to PDF for proposals, contracts, resumes, reports, and submissions while preserving layout and review quality.documentsconverterproductivityDevamını Oku Word to PDF Guide for Final Document Delivery
compression-ratio15 May 2026·3 dk okumaCompression Ratio Practical Workflow GuideUse Compression Ratio for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Compression Ratio Practical Workflow Guide
encoding15 May 2026·3 dk okumaBit Shift Practical Workflow GuideUse Bit Shift for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Bit Shift Practical Workflow Guide
pdf14 May 2026·3 dk okumaPNG to PDF Practical Workflow GuideUse PNG to PDF for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PNG to PDF Practical Workflow Guide
pdf14 May 2026·2 dk okumaPDF Split Guide for Large DocumentsSplit large PDFs into smaller sections for uploads, review packets, chapters, attachments, records, and focused sharing.large-documentsfile-organizationproductivityDevamını Oku PDF Split Guide for Large Documents
networking14 May 2026·3 dk okumaIP Subnet Calculator Practical Workflow GuideUse IP Subnet Calculator for network debugging workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsdebuggingprivacyDevamını Oku IP Subnet Calculator Practical Workflow Guide
seo14 May 2026·3 dk okumaRobots.txt Generator Guide: Control Crawlers Without Blocking SEOLearn how robots.txt works, what it can and cannot do, and how to avoid accidentally blocking important pages.robotsweb-developmentdeveloper-toolssecurityDevamını Oku Robots.txt Generator Guide: Control Crawlers Without Blocking SEO
pdf14 May 2026·3 dk okumaPDF Translator Practical Workflow GuideUse PDF Translator for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Translator Practical Workflow Guide
text-tools14 May 2026·3 dk okumaHTML Escape Guide for Safer Text RenderingUnderstand HTML escaping for user-generated text, examples, snippets, emails, and templates so content renders as text instead of markup.securityfrontenddeveloper-toolsDevamını Oku HTML Escape Guide for Safer Text Rendering
converter14 May 2026·3 dk okumaEnergy Converter Practical Workflow GuideUse Energy Converter for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.calculatormathplanningproductivityDevamını Oku Energy Converter Practical Workflow Guide
encoding13 May 2026·3 dk okumaDecode Layers Practical Workflow GuideUse Decode Layers for safe inspection workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsinspectionprivacyworkflowDevamını Oku Decode Layers Practical Workflow Guide
css13 May 2026·15 dk okumaHEX to RGB Converter — Color Code Guide for Web DevelopersConvert HEX to RGB, HSL, and CMYK color codes instantly. Learn how color systems work in CSS and design with practical examples and a free online converter.designcolordeveloper-toolsfree-toolsDevamını Oku HEX to RGB Converter — Color Code Guide for Web Developers
pdf13 May 2026·3 dk okumaCompress PDF for Email and Upload Limits Without Ruining ReadabilityA practical guide to compressing PDFs for email, forms, portals, and uploads while keeping text and scans readable.compressiondocumentsproductivityfree-toolsDevamını Oku Compress PDF for Email and Upload Limits Without Ruining Readability
calculator12 May 2026·2 dk okumaLoan Calculator Guide: Understand Monthly Payments Before You BorrowUse a loan calculator to understand payment size, interest, term length, total cost, and tradeoffs before taking a loan.financeloanplanningbusinessDevamını Oku Loan Calculator Guide: Understand Monthly Payments Before You Borrow
games12 May 2026·3 dk okuma2048 Strategy Guide: Build Bigger Tiles With Less ChaosLearn practical 2048 strategy for corners, move discipline, board control, recovery, and reaching bigger tiles more consistently.strategybrainDevamını Oku 2048 Strategy Guide: Build Bigger Tiles With Less Chaos
image-tools12 May 2026·17 dk okumaHow to Compress Images Without Losing Quality: The Complete 2026 GuideImage compression isn't just about making files smaller. It's about finding the sweet spot where file size drops 80% but your eyes can't tell the difference.compressionperformancefree-toolsweb-developmentDevamını Oku How to Compress Images Without Losing Quality: The Complete 2026 Guide
qr12 May 2026·3 dk okumaQR Code Scanner Safety Guide: Scan Links Without Getting TrickedLearn QR code safety habits for links, payments, menus, tickets, posters, and suspicious codes before you scan.securityprivacymobilefree-toolsDevamını Oku QR Code Scanner Safety Guide: Scan Links Without Getting Tricked
pdf12 May 2026·2 dk okumaPDF Crop Guide for Cleaner PagesCrop PDF pages for scans, forms, portfolios, worksheets, receipts, and presentations so documents look cleaner and easier to review.documentsscanningproductivityDevamını Oku PDF Crop Guide for Cleaner Pages
converter11 May 2026·3 dk okumaCurrency Converter Practical Workflow GuideUse Currency Converter for converter workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.workflowproductivityonline-toolsDevamını Oku Currency Converter Practical Workflow Guide
regex11 May 2026·4 dk okumaRegex Tester Debugging Guide: Find Pattern Bugs Without GuessworkA practical regex debugging guide with examples, common mistakes, and a workflow for testing patterns safely.developer-toolstextdebuggingprogrammingDevamını Oku Regex Tester Debugging Guide: Find Pattern Bugs Without Guesswork
developer-tools11 May 2026·10 dk okumaFree JSON Formatter, Validator & Beautifier: The Developer's Essential ToolFormat, validate, and beautify JSON instantly in your browser. Syntax highlighting, error detection, tree view, and more — completely free, no data leaves your device.data-formatsweb-developmentapiDevamını Oku Free JSON Formatter, Validator & Beautifier: The Developer's Essential Tool
api11 May 2026·17 dk okuma500+ Free Public APIs for Your Next Project — The Definitive List (2026)Browse 500+ free public APIs organized by category — weather, finance, AI, maps, music, and more. Find the perfect API for your next app or side project.free-toolsweb-developmentprogrammingdeveloper-toolsDevamını Oku 500+ Free Public APIs for Your Next Project — The Definitive List (2026)
business-cards10 May 2026·3 dk okumaBusiness Card Generator Guide for Better NetworkingCreate business cards that communicate identity, contact details, and brand clearly without cluttering the small format.networkingbrandingdesignDevamını Oku Business Card Generator Guide for Better Networking
diff-checker9 May 2026·2 dk okumaDiff Checker Guide for Document ReviewCompare text, drafts, code snippets, configs, copy updates, and data samples with clearer review habits.document-reviewtext-toolsproductivityDevamını Oku Diff Checker Guide for Document Review
design9 May 2026·3 dk okumaAspect Ratio Calculator Guide: Resize Designs Without Awkward CropsUse aspect ratios for social posts, thumbnails, videos, product images, and responsive layouts without stretching or bad crops.image-toolssocial-mediacalculatorfree-toolsDevamını Oku Aspect Ratio Calculator Guide: Resize Designs Without Awkward Crops
typescript9 May 2026·24 dk okumaTypeScript Compiler API: Building Custom Linters, Codemods, and Type AnalyzersA practical guide to the TypeScript Compiler API. Build custom linters that leverage type information ESLint cannot access, write codemods that understand your type system, and create IDE-like tooling using the Language Service API.compilertoolingastdeveloper-toolsDevamını Oku TypeScript Compiler API: Building Custom Linters, Codemods, and Type Analyzers
uuid7 May 2026·4 dk okumaUUID Generator Guide for Safer Test Data and IDsUse UUIDs in test data, fixtures, prototypes, and internal workflows without creating collisions, leaking real IDs, or confusing environments.developer-toolstestingdataDevamını Oku UUID Generator Guide for Safer Test Data and IDs
encoding7 May 2026·3 dk okumaBase85 Encode Practical Workflow GuideUse Base85 Encode for converter workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.converterworkflowproductivityonline-toolsDevamını Oku Base85 Encode Practical Workflow Guide
ai7 May 2026·2 dk okumaAI Code Generator Guide for Learning and PrototypesUse an AI code generator for learning, small prototypes, examples, refactoring ideas, and review support without skipping verification.coding-workflowprototypeslearningDevamını Oku AI Code Generator Guide for Learning and Prototypes
image-tools7 May 2026·14 dk okumaFree Photo Editing in 2026: You Don't Need Photoshop AnymoreBrowser-based photo editors now have layers, masks, AI background removal, and GPU acceleration. Here's why I cancelled my Photoshop subscription.free-toolsdesignproductivityaiDevamını Oku Free Photo Editing in 2026: You Don't Need Photoshop Anymore
text-tools7 May 2026·2 dk okumaText Truncate Guide for Preview CopyTruncate preview text for cards, tables, notifications, meta snippets, and UI lists while preserving meaning and avoiding awkward cuts.writingpreviewscontent-designDevamını Oku Text Truncate Guide for Preview Copy
url-extraction6 May 2026·2 dk okumaExtract URLs Guide for Content AuditsExtract URLs from pages, notes, exports, emails, and documents to audit links, redirects, campaigns, references, and source lists.content-auditlinksseoDevamını Oku Extract URLs Guide for Content Audits
pdf6 May 2026·2 dk okumaPDF Repair Guide for Broken FilesTry PDF repair for files that will not open, display missing pages, fail uploads, or appear damaged after transfer.broken-filesdocument-recoveryproductivityDevamını Oku PDF Repair Guide for Broken Files
games6 May 2026·22 dk okuma50 Best Free Online Games You Can Play Right Now: No Download, No SignupBored at work? Waiting for a flight? Here are 50 free browser games you can play instantly — puzzles, arcade, strategy, word games — no download, no account.entertainmentonline-gamingDevamını Oku 50 Best Free Online Games You Can Play Right Now: No Download, No Signup
pdf6 May 2026·3 dk okumaPDF Compare Practical Workflow GuideUse PDF Compare for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Compare Practical Workflow Guide
calculator5 May 2026·3 dk okumaGCD and LCM Practical Workflow GuideUse GCD and LCM for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.mathplanningproductivityDevamını Oku GCD and LCM Practical Workflow Guide
pdf5 May 2026·2 dk okumaPDF Sign Guide for Document ApprovalSign PDFs for approvals, acknowledgments, forms, packets, and internal workflows with clearer review and file handling habits.document-approvalformsproductivityDevamını Oku PDF Sign Guide for Document Approval
calculator5 May 2026·3 dk okumaPercentage Calculator Guide for Discounts and GrowthUse percentages more accurately for discounts, price changes, reports, grades, growth, comparisons, and everyday decisions.math-toolsdiscountsproductivityDevamını Oku Percentage Calculator Guide for Discounts and Growth
data-formats5 May 2026·3 dk okumaJSON Diff Practical Workflow GuideUse JSON Diff for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku JSON Diff Practical Workflow Guide
developer-tools5 May 2026·16 dk okumaThe Best Free Online Code Editors in 2026: Write Code AnywhereModern browser-based code editors support 50+ languages, Vim keybindings, themes, and real terminal access. Here's what actually works for real development.programmingfree-toolsweb-developmentDevamını Oku The Best Free Online Code Editors in 2026: Write Code Anywhere
email-headers5 May 2026·3 dk okumaEmail Header Analyzer Guide for Phishing InvestigationAnalyze email headers to investigate suspicious messages, trace delivery paths, inspect authentication results, and document phishing reports.phishingsecurityinvestigationDevamını Oku Email Header Analyzer Guide for Phishing Investigation
image-tools5 May 2026·3 dk okumaSVG to JPG Practical Workflow GuideUse SVG to JPG for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku SVG to JPG Practical Workflow Guide
pdf5 May 2026·3 dk okumaPDF Compress Guide for Easier File SharingCompress PDFs for email, applications, uploads, client review, and archives while preserving readability and document trust.file-sharingdocumentsproductivityDevamını Oku PDF Compress Guide for Easier File Sharing
text-tools3 May 2026·10 dk okumaFree Text Tools Every Writer and Content Creator NeedsDiscover 53+ free text tools for writers and content creators. Word counters, case converters, text formatters, lorem ipsum generators, and more.writingcontent-creationfree-toolsDevamını Oku Free Text Tools Every Writer and Content Creator Needs
resume2 May 2026·12 dk okumaHow to Build a Professional Resume for Free in 2026Create a professional resume for free with expert tips on formatting, content, ATS optimization, and common mistakes to avoid. No signup or templates needed.careerfree-toolsproductivityDevamını Oku How to Build a Professional Resume for Free in 2026
data-visualization-studio2 May 2026·3 dk okumaData Visualization Studio Practical Workflow GuideUse Data Visualization Studio for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku Data Visualization Studio Practical Workflow Guide
image-tools2 May 2026·11 dk okumaConvert Images Online Free: PNG, JPG, WebP, SVG and MoreConvert images between PNG, JPG, WebP, SVG, GIF and more formats for free. No upload needed — all conversions happen in your browser for maximum privacy.converterfree-toolsweb-developmentDevamını Oku Convert Images Online Free: PNG, JPG, WebP, SVG and More
image-tools1 May 2026·2 dk okumaImage Upscaler Guide for Low-Resolution PhotosUpscale low-resolution images for presentations, archives, product pages, and content drafts while checking quality and avoiding overuse.content-productionDevamını Oku Image Upscaler Guide for Low-Resolution Photos
email-templates1 May 2026·2 dk okumaEmail Template Builder Guide for Campaign WorkflowsBuild reusable email templates for launches, onboarding, newsletters, and support workflows with clearer structure and fewer mistakes.campaignsmarketingproductivityDevamını Oku Email Template Builder Guide for Campaign Workflows
games1 May 2026·3 dk okumaMinesweeper Beginner Patterns: Solve More Boards Without GuessingLearn beginner Minesweeper patterns, safe clicks, flags, number logic, and common mistakes that lead to avoidable losses.strategybrainDevamını Oku Minesweeper Beginner Patterns: Solve More Boards Without Guessing
ai1 May 2026·2 dk okumaAI Image Generator Guide for Creative BriefsWrite stronger creative briefs for AI image generation across blog visuals, product concepts, social posts, and mood exploration.creative-briefsvisual-contentdesign-workflowDevamını Oku AI Image Generator Guide for Creative Briefs
image-tools1 May 2026·3 dk okumaSVG to PNG Practical Workflow GuideUse SVG to PNG for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku SVG to PNG Practical Workflow Guide
png30 Nis 2026·3 dk okumaPNG to WebP Guide for Faster Website ImagesConvert PNG images to WebP for better page performance while protecting transparency, sharp edges, screenshots, and visual quality.webpweb-performanceimage-toolsDevamını Oku PNG to WebP Guide for Faster Website Images
networking30 Nis 2026·3 dk okumaSSL Certificate Parser Guide for Certificate DebuggingInspect SSL certificates to debug expiration, hostname mismatch, chain issues, issuer changes, and HTTPS rollout problems.certificatesdebuggingDevamını Oku SSL Certificate Parser Guide for Certificate Debugging
pdf30 Nis 2026·2 dk okumaPDF Unlock Guide for Permission-Based WorkflowsUse PDF unlock workflows responsibly for files you own or have permission to edit, print, merge, split, or annotate.document-permissionsproductivityDevamını Oku PDF Unlock Guide for Permission-Based Workflows
text-tools30 Nis 2026·2 dk okumaDuplicate Line Remover Guide for List CleanupRemove duplicate lines from keyword lists, emails, IDs, logs, exports, and research notes while preserving useful order and context.data-cleanuplistsproductivityDevamını Oku Duplicate Line Remover Guide for List Cleanup
html29 Nis 2026·9 dk okumaHow to Convert HTML to PDF for Free: Methods and ToolsLearn how to convert HTML pages to PDF for free. Compare browser methods, online tools, and programmatic approaches for perfect HTML-to-PDF conversion.pdfconverterweb-developmentDevamını Oku How to Convert HTML to PDF for Free: Methods and Tools
encoding29 Nis 2026·3 dk okumaBase32 Encode Practical Workflow GuideUse Base32 Encode for converter workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.converterworkflowproductivityonline-toolsDevamını Oku Base32 Encode Practical Workflow Guide
developer-tools29 Nis 2026·11 dk okumaFree Online Code Editor: Write and Run Code in 53+ RuntimesWrite, run, and share code in 53+ runtimes with a free online IDE. Features syntax highlighting, 10 themes, Vim mode, and instant execution.programmingDevamını Oku Free Online Code Editor: Write and Run Code in 53+ Runtimes
text-tools29 Nis 2026·2 dk okumaText Trimmer Guide for Whitespace CleanupTrim extra spaces, blank lines, tabs, and invisible whitespace from copied text, CSV values, forms, code snippets, and content drafts.data-cleanupproductivityDevamını Oku Text Trimmer Guide for Whitespace Cleanup
games28 Nis 2026·2 dk okumaBingo Card Generator Guide for Classrooms and EventsCreate better bingo cards for classrooms, parties, team activities, fundraisers, and workshops with clearer prompts and pacing.educationprintable-toolsDevamını Oku Bingo Card Generator Guide for Classrooms and Events
text-tools28 Nis 2026·3 dk okumaPlaceholder Text Practical Workflow GuideUse Placeholder Text for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.writingeditingproductivityDevamını Oku Placeholder Text Practical Workflow Guide
converter28 Nis 2026·3 dk okumaShoe Size Converter Practical Workflow GuideUse Shoe Size Converter for converter workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.workflowproductivityonline-toolsDevamını Oku Shoe Size Converter Practical Workflow Guide
text-tools28 Nis 2026·3 dk okumaText Repeater Practical Workflow GuideUse Text Repeater for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.writingeditingproductivityDevamını Oku Text Repeater Practical Workflow Guide
text-tools28 Nis 2026·2 dk okumaHTML Stripper Guide for Content CleanupStrip HTML tags from copied pages, CMS exports, emails, and templates when you need clean text for editing, imports, or analysis.content-cleanupproductivityDevamını Oku HTML Stripper Guide for Content Cleanup
pdf28 Nis 2026·3 dk okumaPDF Rotate Guide for Fixing Scanned Page OrientationRotate sideways or upside-down PDF pages after scanning so forms, receipts, contracts, and reports are easier to read and submit.scanningdocumentsproductivityDevamını Oku PDF Rotate Guide for Fixing Scanned Page Orientation
encoding28 Nis 2026·3 dk okumaHMAC Generator Practical Workflow GuideUse HMAC Generator for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku HMAC Generator Practical Workflow Guide
web-performance27 Nis 2026·24 dk okumaHow to Test Your Website Speed for Free in 2026: Tools, Metrics, and FixesSlow websites lose visitors and rankings. Here's how to test your site's speed for free, understand Core Web Vitals, and fix the most common performance killers.seofree-toolsweb-developmentonline-toolsDevamını Oku How to Test Your Website Speed for Free in 2026: Tools, Metrics, and Fixes
text-tools27 Nis 2026·3 dk okumaLine Counter Practical Workflow GuideUse Line Counter for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.writingeditingproductivityDevamını Oku Line Counter Practical Workflow Guide
logo27 Nis 2026·3 dk okumaLogo Maker Guide: Create a Simple Brand Mark That Still WorksUse a logo maker to explore brand marks, then check readability, scalability, contrast, file formats, and real-world usage.brandingdesigngeneratorbusinessDevamını Oku Logo Maker Guide: Create a Simple Brand Mark That Still Works
generator27 Nis 2026·3 dk okumaMarkdown Table Generator Practical Workflow GuideUse Markdown Table Generator for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Markdown Table Generator Practical Workflow Guide
stopwatch27 Nis 2026·3 dk okumaStopwatch Practical Workflow GuideUse Stopwatch for time planning workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.time-toolsplanningproductivityschedulingDevamını Oku Stopwatch Practical Workflow Guide
developer-tools27 Nis 2026·15 dk okumaBest Free Online Code Formatters and Beautifiers in 2026: JSON, SQL, HTML, CSS, and MoreMessy code? Paste it in, get it formatted. Free browser-based code formatters for JSON, SQL, HTML, CSS, JavaScript, Python, XML, and 50+ languages — no IDE needed.free-toolscodingproductivityonline-toolsDevamını Oku Best Free Online Code Formatters and Beautifiers in 2026: JSON, SQL, HTML, CSS, and More
image-tools27 Nis 2026·3 dk okumaImage Background Remover Guide for Product PhotosRemove image backgrounds for cleaner product photos, profile images, marketplace listings, and marketing assets without losing credibility.product-photosecommercedesignDevamını Oku Image Background Remover Guide for Product Photos
markdown-preview27 Nis 2026·2 dk okumaMarkdown Preview Guide for Writing WorkflowsPreview Markdown for READMEs, docs, notes, blog drafts, changelogs, and course material with fewer formatting surprises.documentationwritingproductivityDevamını Oku Markdown Preview Guide for Writing Workflows
converter26 Nis 2026·3 dk okumaClothing Size Converter Practical Workflow GuideUse Clothing Size Converter for converter workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.workflowproductivityonline-toolsDevamını Oku Clothing Size Converter Practical Workflow Guide
downdetector25 Nis 2026·17 dk okumaIs It Down Right Now? How to Check If a Website Is DownFind out if a website is down for everyone or just you. Learn how to check server status, diagnose outages, and get real-time downtime alerts for 1700+ services.monitoringweb-developmentonline-toolstroubleshootingDevamını Oku Is It Down Right Now? How to Check If a Website Is Down
encoding25 Nis 2026·3 dk okumaBinary Data to Text Practical Workflow GuideUse Binary Data to Text for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku Binary Data to Text Practical Workflow Guide
data-formats24 Nis 2026·2 dk okumaJSON Formatter Guide for Error CheckingFormat and inspect JSON for API responses, settings, logs, exports, examples, and data cleanup with fewer mistakes.data-cleanupdeveloper-toolsapiDevamını Oku JSON Formatter Guide for Error Checking
pdf24 Nis 2026·2 dk okumaPDF to PowerPoint Guide for Presentation ReuseConvert PDFs into presentation slides for updates, training, lessons, review decks, and reusable visual material.presentationsslide-workflowproductivityDevamını Oku PDF to PowerPoint Guide for Presentation Reuse
email-signature24 Nis 2026·3 dk okumaEmail Signature Generator Guide for Professional BrandingCreate email signatures that look professional, stay readable on mobile, support brand consistency, and avoid common deliverability issues.brandingbusiness-communicationproductivityDevamını Oku Email Signature Generator Guide for Professional Branding
image-tools24 Nis 2026·3 dk okumaGIF to PNG Practical Workflow GuideUse GIF to PNG for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku GIF to PNG Practical Workflow Guide
generator24 Nis 2026·2 dk okumaCertificate Generator Guide for Course CompletionDesign clearer certificates for courses, workshops, training sessions, clubs, awards, and community programs.educationtrainingdesignDevamını Oku Certificate Generator Guide for Course Completion
pdf23 Nis 2026·2 dk okumaPDF Password Guide for Sensitive SharingUse PDF passwords more thoughtfully for forms, records, drafts, client packets, internal files, and limited-access document sharing.sensitive-documentsfile-sharingproductivityDevamını Oku PDF Password Guide for Sensitive Sharing
data-formats23 Nis 2026·3 dk okumaJSON to CSV Guide for Reporting ExportsConvert JSON into CSV for spreadsheets, reporting, audits, and stakeholder review without flattening important structure carelessly.reportingspreadsheetsdata-cleanupDevamını Oku JSON to CSV Guide for Reporting Exports
image-tools23 Nis 2026·2 dk okumaAVIF to PNG Guide for Design WorkflowsConvert AVIF images to PNG for transparent graphics, screenshots, design handoff, documentation, and compatibility workflows.design-workflowtransparent-imagesDevamını Oku AVIF to PNG Guide for Design Workflows
pdf23 Nis 2026·3 dk okumaPDF to PNG Practical Workflow GuideUse PDF to PNG for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF to PNG Practical Workflow Guide
games23 Nis 2026·12 dk okumaBest Free Brain Training Games to Sharpen Your Mind in 2026Boost your cognitive skills with free brain training games. Play puzzles, strategy games, word games, and memory challenges directly in your browser.cognitiveDevamını Oku Best Free Brain Training Games to Sharpen Your Mind in 2026
audio23 Nis 2026·3 dk okumaAudio Noise Remover Guide for Cleaner RecordingsClean background noise from voice recordings, podcasts, interviews, videos, and lessons without making speech sound thin or artificial.recordingcontent-creationDevamını Oku Audio Noise Remover Guide for Cleaner Recordings
extract-ips23 Nis 2026·3 dk okumaExtract Ips Practical Workflow GuideUse Extract Ips for safe inspection workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsinspectionprivacyworkflowDevamını Oku Extract Ips Practical Workflow Guide
developer-tools22 Nis 2026·21 dk okumaFree API Testing Tools in 2026: Why You Don't Need Postman PremiumPostman went from free to $14/month. Here are the browser-based API testing tools that do everything you need — request building, auth, environments, and history.apitestingfree-toolsweb-developmentDevamını Oku Free API Testing Tools in 2026: Why You Don't Need Postman Premium
encoding21 Nis 2026·3 dk okumaText to Binary Practical Workflow GuideUse Text to Binary for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Text to Binary Practical Workflow Guide
image-tools21 Nis 2026·2 dk okumaImage Background Remover Guide for Product PhotosRemove image backgrounds for product photos, profile assets, listings, presentations, and marketing visuals with cleaner edges.product-photosecommerceDevamını Oku Image Background Remover Guide for Product Photos
color21 Nis 2026·3 dk okumaColor Blindness Simulator Guide for Accessibility ReviewUse color blindness simulation to review charts, forms, buttons, maps, and status states so color is not the only signal.accessibilityui-designinclusive-designDevamını Oku Color Blindness Simulator Guide for Accessibility Review
data-formats21 Nis 2026·4 dk okumaCSV to JSON Workflow: Clean Data Before It Breaks Your AppA practical CSV to JSON workflow for developers, analysts, and teams importing messy spreadsheet data into apps and APIs.datadeveloper-toolsconverterDevamını Oku CSV to JSON Workflow: Clean Data Before It Breaks Your App
slugs21 Nis 2026·2 dk okumaSlug Generator Guide for Clean URLsCreate readable URL slugs for blog posts, tools, products, categories, and landing pages with fewer duplication and migration issues.networkingseocontent-managementDevamını Oku Slug Generator Guide for Clean URLs
pdf21 Nis 2026·3 dk okumaWebP to PDF Practical Workflow GuideUse WebP to PDF for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku WebP to PDF Practical Workflow Guide
text20 Nis 2026·4 dk okumaWord Counter for Content Briefs: Plan Better Articles Before You WriteUse a word counter to plan content briefs, estimate reading time, control scope, and make articles easier to edit.writingseocontentfree-toolsDevamını Oku Word Counter for Content Briefs: Plan Better Articles Before You Write
api20 Nis 2026·11 dk okuma500+ Free Public APIs for Your Next Project in 2026Browse 500+ free public APIs organized by category. Find the perfect API for your next project — from weather and news to AI and finance.web-developmentdeveloper-toolsfree-resourcesDevamını Oku 500+ Free Public APIs for Your Next Project in 2026
data-formats20 Nis 2026·2 dk okumaCSV to JSON Guide for Data ImportsConvert CSV files into JSON for imports, prototypes, APIs, mock data, content migration, and structured handoffs.data-importstructured-datadeveloper-toolsDevamını Oku CSV to JSON Guide for Data Imports
open-graph20 Nis 2026·4 dk okumaOG Image Preview Checklist for Sharper Social CardsUse this practical checklist to design, preview, and ship Open Graph images that look clear when links are shared across social platforms.social-mediaseocontent-marketingDevamını Oku OG Image Preview Checklist for Sharper Social Cards
converter20 Nis 2026·2 dk okumaBase Converter Guide for Programming NumbersConvert numbers between binary, decimal, hexadecimal, and other bases for debugging, teaching, encoding, and low-level programming.programmingnumbersdeveloper-toolsDevamını Oku Base Converter Guide for Programming Numbers
generator20 Nis 2026·2 dk okumaCalendar Generator Guide for Printable PlanningCreate printable calendars for study plans, content schedules, family routines, events, habits, and team planning.printable-plannerproductivityschedulingDevamını Oku Calendar Generator Guide for Printable Planning
css19 Nis 2026·3 dk okumaCSS Unit Converter Practical Workflow GuideUse CSS Unit Converter for front-end design workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designfrontendworkflowDevamını Oku CSS Unit Converter Practical Workflow Guide
tools19 Nis 2026·15 dk okumaBest Free CSS Animation & Gradient Generator Tools 2026 — No Coding NeededGenerate CSS animations, gradients, shadows, and transitions visually — no manual coding required. Copy clean CSS code and paste into your projects.web-developmentcssdesignDevamını Oku Best Free CSS Animation & Gradient Generator Tools 2026 — No Coding Needed
multiplayer19 Nis 2026·11 dk okumaBest Free Multiplayer Browser Games to Play with FriendsDiscover the best free multiplayer browser games you can play with friends. Real-time board games, strategy games, and even a 3D FPS — no downloads needed.games2026Devamını Oku Best Free Multiplayer Browser Games to Play with Friends
writing18 Nis 2026·3 dk okumaGrammar Checker Guide for Clearer Business WritingUse a grammar checker to polish emails, proposals, reports, and web copy without losing your voice or introducing careless edits.editingproductivityDevamını Oku Grammar Checker Guide for Clearer Business Writing
generator18 Nis 2026·2 dk okumaQR Code Generator Guide for Event MarketingCreate QR codes for events, menus, signups, posters, tickets, feedback forms, and campaigns with better testing habits.event-marketingcampaignsprint-designDevamını Oku QR Code Generator Guide for Event Marketing
diff17 Nis 2026·3 dk okumaDiff Checker Guide for Faster Review WorkflowsCompare text, JSON, configs, drafts, and generated output with a diff workflow that makes changes easier to review and trust.reviewdocumentationdeveloper-toolsDevamını Oku Diff Checker Guide for Faster Review Workflows
networking17 Nis 2026·3 dk okumaCIDR Calculator Practical Workflow GuideUse CIDR Calculator for network debugging workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsdebuggingprivacyDevamını Oku CIDR Calculator Practical Workflow Guide
pdf17 Nis 2026·3 dk okumaSVG to PDF Practical Workflow GuideUse SVG to PDF for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku SVG to PDF Practical Workflow Guide
data-formats17 Nis 2026·3 dk okumaJSON Path Finder Guide for Deep Data InspectionFind nested JSON paths in API payloads, logs, analytics events, and configs so data mapping and debugging become easier.data-inspectionapideveloper-toolsDevamını Oku JSON Path Finder Guide for Deep Data Inspection
number-to-words17 Nis 2026·3 dk okumaNumber to Words Practical Workflow GuideUse Number to Words for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Number to Words Practical Workflow Guide
tools17 Nis 2026·13 dk okumaTranslate Documents & PDFs Free Online 2026 — Keep Formatting IntactTranslate documents, PDFs, and files online for free while keeping the original formatting. Compare the best free document translation tools and their accuracy.productivitytranslationDevamını Oku Translate Documents & PDFs Free Online 2026 — Keep Formatting Intact
video17 Nis 2026·3 dk okumaVideo to GIF Guide: Create Small Shareable Loops Without Huge FilesLearn how to convert video to GIF for demos, reactions, tutorials, and social posts while keeping file size under control.gifconvertersocial-mediafree-toolsDevamını Oku Video to GIF Guide: Create Small Shareable Loops Without Huge Files
ai17 Nis 2026·3 dk okumaAI Image Generator Guide for Better Prompt WorkflowsUse AI image generation for campaigns, concepts, mood boards, and content assets with clearer prompts, review steps, and reuse rules.writingvisual-contentcreative-workflowDevamını Oku AI Image Generator Guide for Better Prompt Workflows
developer-tools15 Nis 2026·15 dk okumaRegex Made Simple: A Practical Guide With an Online TesterRegular expressions don't have to be cryptic. Here's a practical guide with real-world patterns for emails, URLs, dates, and more — plus how to test them instantly.regexprogrammingjavascriptfree-toolsDevamını Oku Regex Made Simple: A Practical Guide With an Online Tester
generator15 Nis 2026·2 dk okumaHashtag Generator Guide for Social ContentUse a hashtag generator to build better social post sets by topic, audience, platform, campaign, and content intent.social-mediacontent-planningmarketingDevamını Oku Hashtag Generator Guide for Social Content
pdf15 Nis 2026·2 dk okumaHTML to PDF Guide for Web Page ArchivesConvert HTML pages to PDFs for records, reports, invoices, receipts, articles, documentation, and offline review.web-archivedocumentsproductivityDevamını Oku HTML to PDF Guide for Web Page Archives
data-formats15 Nis 2026·2 dk okumaTOML Validator Guide: Cleaner Configuration With Fewer SurprisesUnderstand TOML validation, tables, arrays, strings, dates, and practical configuration checks for modern development tools.developer-toolsconfigurationvalidationprogrammingDevamını Oku TOML Validator Guide: Cleaner Configuration With Fewer Surprises
calculator15 Nis 2026·2 dk okumaDate Calculator Guide for Project PlanningUse date calculations for deadlines, schedules, event planning, study plans, review cycles, and project timelines.project-planningschedulingproductivityDevamını Oku Date Calculator Guide for Project Planning
internet15 Nis 2026·22 dk okumaHow to Test Your Internet Speed (And What the Numbers Actually Mean)Download speed, upload speed, ping, jitter — most people don't know what these numbers mean or what 'good' looks like. Here's the plain-English explanation.networkingtroubleshootingonline-toolsperformanceDevamını Oku How to Test Your Internet Speed (And What the Numbers Actually Mean)
pdf15 Nis 2026·2 dk okumaPDF Organize Guide for Page ManagementOrganize PDF pages for reports, packets, scans, applications, manuals, worksheets, and review documents with cleaner structure.page-managementdocument-workflowproductivityDevamını Oku PDF Organize Guide for Page Management
ai15 Nis 2026·3 dk okumaAI Writer Guide for Turning Briefs into Better DraftsUse an AI writer with strong briefs, source notes, audience context, and editing passes so generated drafts become useful content.content-strategybriefseditingDevamını Oku AI Writer Guide for Turning Briefs into Better Drafts
audio13 Nis 2026·3 dk okumaLyrics Generator Practical Workflow GuideUse Lyrics Generator for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Lyrics Generator Practical Workflow Guide
writing13 Nis 2026·3 dk okumaCitation Generator Guide: Cite Sources Clearly and Avoid PlagiarismUse citation generators responsibly for essays, reports, articles, and research projects without losing track of source quality.educationresearchgeneratorDevamını Oku Citation Generator Guide: Cite Sources Clearly and Avoid Plagiarism
games13 Nis 2026·3 dk okumaReaction Time Test Practical Workflow GuideUse Reaction Time Test for time planning workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.time-toolsplanningproductivityschedulingDevamını Oku Reaction Time Test Practical Workflow Guide
pixel-art13 Nis 2026·2 dk okumaPhoto to Pixel Art Guide for Game AssetsTurn photos into pixel-art references, avatars, sprites, and creative assets while controlling resolution, palette, and readability.game-assetsimage-toolscreative-workflowDevamını Oku Photo to Pixel Art Guide for Game Assets
pdf13 Nis 2026·2 dk okumaPDF to Word Guide for Editing WorkflowsConvert PDFs to Word documents for editing drafts, updating old files, extracting sections, and collaborating on revisions.document-editingconverterproductivityDevamını Oku PDF to Word Guide for Editing Workflows
games13 Nis 2026·12 dk okumaBest Free Online Chess, Sudoku & Strategy Games: Train Your BrainPlay chess against a grandmaster-level AI, solve unlimited Sudoku puzzles, and challenge your mind with strategy games — all free in your browser.brain-trainingDevamını Oku Best Free Online Chess, Sudoku & Strategy Games: Train Your Brain
pdf12 Nis 2026·3 dk okumaPDF to Image Practical Workflow GuideUse PDF to Image for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF to Image Practical Workflow Guide
data-visualization12 Nis 2026·30 dk okumaHow to Make Charts and Graphs Online for Free: The Complete 2026 GuideBar charts, pie charts, line graphs, scatter plots — create beautiful data visualizations for free in your browser. Export to PNG, SVG, or embed anywhere.free-toolsproductivityeducationonline-toolsDevamını Oku How to Make Charts and Graphs Online for Free: The Complete 2026 Guide
text-tools12 Nis 2026·3 dk okumaCharacter Counter Guide for Microcopy LimitsUse character counting to write cleaner titles, ads, bios, buttons, meta descriptions, SMS copy, and UI labels inside strict limits.writingcontent-designDevamını Oku Character Counter Guide for Microcopy Limits
pdf11 Nis 2026·3 dk okumaPDF Repair Guide for Corrupted File RecoveryTry practical PDF repair steps when files will not open, previews fail, uploads reject documents, or page structures appear damaged.documentstroubleshootingfile-recoveryDevamını Oku PDF Repair Guide for Corrupted File Recovery
image-tools11 Nis 2026·3 dk okumaSVG to WebP Practical Workflow GuideUse SVG to WebP for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku SVG to WebP Practical Workflow Guide
security11 Nis 2026·25 dk okumaHow to Generate Strong Passwords in 2026: The Complete Security Guide123456 is still the most common password. Here's how to generate truly unbreakable passwords, check if yours have been leaked, and manage them without losing your mind.passwordfree-toolsprivacyonline-toolsDevamını Oku How to Generate Strong Passwords in 2026: The Complete Security Guide
converter11 Nis 2026·2 dk okumaTime Zone Converter Guide for Meeting PlanningPlan meetings across time zones with clearer conversions, daylight saving checks, calendar wording, and participant-friendly timing.meetingsremote-workschedulingDevamını Oku Time Zone Converter Guide for Meeting Planning
education10 Nis 2026·3 dk okumaFlashcard Maker Guide for a Better Study SystemCreate flashcards that support active recall, spaced review, exam preparation, language learning, and skill practice without rote clutter.productivityDevamını Oku Flashcard Maker Guide for a Better Study System
pdf10 Nis 2026·3 dk okumaPDF Page Size Practical Workflow GuideUse PDF Page Size for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Page Size Practical Workflow Guide
generator10 Nis 2026·2 dk okumaLorem Ipsum Guide for Layout TestingUse lorem ipsum text for wireframes, mockups, templates, content blocks, spacing tests, and design review without confusing users.layout-testingdesign-workflowmockupsDevamını Oku Lorem Ipsum Guide for Layout Testing
design9 Nis 2026·15 dk okumaBest Free Icon Libraries & SVG Icon Sets 2026 — Download & Use AnywhereDiscover the best free icon libraries with thousands of SVG icons for websites, apps, and design projects. Compare licenses, styles, and how to use them.web-developmenttoolsDevamını Oku Best Free Icon Libraries & SVG Icon Sets 2026 — Download & Use Anywhere
calculator9 Nis 2026·3 dk okumaUnit Converter Guide: Avoid Measurement Mistakes in Real WorkflowsA practical unit conversion guide for engineering, cooking, design, travel, education, and everyday measurement mistakes.convertermathproductivityfree-toolsDevamını Oku Unit Converter Guide: Avoid Measurement Mistakes in Real Workflows
generator9 Nis 2026·2 dk okumaCover Letter Generator Guide for Job ApplicationsCreate stronger cover letter drafts for job applications by focusing on fit, evidence, tone, and careful revision.job-applicationswritingproductivityDevamını Oku Cover Letter Generator Guide for Job Applications
luhn-check8 Nis 2026·3 dk okumaLuhn Check Practical Workflow GuideUse Luhn Check for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.calculatormathplanningproductivityDevamını Oku Luhn Check Practical Workflow Guide
encoding8 Nis 2026·3 dk okumaBase64 Encoder and Decoder Guide for API WorkflowsUnderstand when to encode, decode, validate, and inspect Base64 data in APIs, files, tokens, payloads, and developer debugging workflows.apideveloper-toolsDevamını Oku Base64 Encoder and Decoder Guide for API Workflows
writing8 Nis 2026·3 dk okumaParaphrasing Tool Practical Workflow GuideUse Paraphrasing Tool for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolseditingproductivityDevamını Oku Paraphrasing Tool Practical Workflow Guide
text-tools8 Nis 2026·3 dk okumaText Behind Image Practical Workflow GuideUse Text Behind Image for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.image-toolsdesignworkflowmediaDevamını Oku Text Behind Image Practical Workflow Guide
pdf8 Nis 2026·17 dk okumaFree PDF Tools That Actually Work: The No-BS GuideMost free PDF tools are ad-infested or upload your files to sketchy servers. Here's how to find ones that process everything locally in your browser.free-toolsproductivityprivacyonline-toolsDevamını Oku Free PDF Tools That Actually Work: The No-BS Guide
encoding8 Nis 2026·3 dk okumaHash Generator Guide for File Integrity ChecksUse hashes to compare files, verify changes, document releases, and detect accidental corruption in safer technical workflows.file-integritysecuritydeveloper-toolsDevamını Oku Hash Generator Guide for File Integrity Checks
pdf8 Nis 2026·2 dk okumaPDF Page Numbers Guide for Report NavigationAdd page numbers to PDFs for reports, packets, proposals, worksheets, manuals, and review documents that need clearer navigation.report-navigationdocumentsproductivityDevamını Oku PDF Page Numbers Guide for Report Navigation
writing8 Nis 2026·3 dk okumaReadability Score Guide for Better Content OptimizationUse readability scores to make articles, landing pages, help docs, and product copy easier to scan, understand, and act on.seocontent-optimizationDevamını Oku Readability Score Guide for Better Content Optimization
developer-tools8 Nis 2026·3 dk okumaUUID Generator Guide: When to Use UUIDs and When Not ToLearn when UUIDs are useful for apps, databases, APIs, distributed systems, and public identifiers, plus common mistakes.databaseapiuuidprogrammingDevamını Oku UUID Generator Guide: When to Use UUIDs and When Not To
qr7 Nis 2026·4 dk okumaQR Code Generator for Business: Practical Campaigns That People Actually ScanLearn practical QR code use cases for businesses, events, menus, packaging, forms, reviews, and offline-to-online campaigns.marketingbusinessgeneratorfree-toolsDevamını Oku QR Code Generator for Business: Practical Campaigns That People Actually Scan
emoji-picker7 Nis 2026·3 dk okumaEmoji Picker Practical Workflow GuideUse Emoji Picker for text workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.textworkflowproductivityonline-toolsDevamını Oku Emoji Picker Practical Workflow Guide
data-formats7 Nis 2026·3 dk okumaYAML Validator Guide for Configuration DebuggingCatch indentation, duplicate keys, syntax mistakes, and configuration risks before YAML files break deployments or local environments.configurationdevopsdeveloper-toolsDevamını Oku YAML Validator Guide for Configuration Debugging
encoding7 Nis 2026·3 dk okumaMorse Code Practical Workflow GuideUse Morse Code for converter workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.converterworkflowproductivityonline-toolsDevamını Oku Morse Code Practical Workflow Guide
text-tools7 Nis 2026·3 dk okumaInvisible Char Detector Practical Workflow GuideUse Invisible Char Detector for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.writingeditingproductivityDevamını Oku Invisible Char Detector Practical Workflow Guide
image-tools7 Nis 2026·3 dk okumaHEIC to JPG Practical Workflow GuideUse HEIC to JPG for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku HEIC to JPG Practical Workflow Guide
whiteboard7 Nis 2026·4 dk okumaWhiteboard Tool Guide for Better Remote WorkshopsRun clearer remote workshops with a whiteboard workflow that supports planning, facilitation, decision making, and follow-through.remote-workworkshopscollaborationDevamını Oku Whiteboard Tool Guide for Better Remote Workshops
generator6 Nis 2026·3 dk okumaCUID Generator Practical Workflow GuideUse CUID Generator for creation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.creative-workflowproductivityplanningDevamını Oku CUID Generator Practical Workflow Guide
ai6 Nis 2026·3 dk okumaAI Headshot Generator Guide for Profile PhotosCreate professional-looking profile photo options with AI while keeping identity, accuracy, context, and platform expectations in mind.profile-photospersonal-brandingprofessional-presenceDevamını Oku AI Headshot Generator Guide for Profile Photos
privacy6 Nis 2026·17 dk okumaYour Browser Is the Most Private Tool You Own (If You Use It Right)Your browser can encrypt, hash, convert, and process files without sending a single byte to any server. Here's how to use it as your privacy-first toolkit.securityfree-toolsbrowseronline-toolsDevamını Oku Your Browser Is the Most Private Tool You Own (If You Use It Right)
developer-tools6 Nis 2026·21 dk okumaJSON Formatter and Validator: The Developer Tool You Use Every Single DayIf you work with APIs, you format JSON daily. Here's why browser-based formatters beat CLI tools for quick validation — and the features that actually matter.data-formatsapiprogrammingfree-toolsDevamını Oku JSON Formatter and Validator: The Developer Tool You Use Every Single Day
generator5 Nis 2026·2 dk okumaBarcode Generator Guide for Retail LabelsCreate clearer barcode labels for retail, inventory, storage, product samples, checkout workflows, and small business operations.retail-labelsinventorysmall-businessDevamını Oku Barcode Generator Guide for Retail Labels
encoding4 Nis 2026·12 dk okumaBase64 Encode and Decode — What It Is and How to Use ItUnderstand Base64 encoding and decoding with practical examples. Learn when to use it, how it works under the hood, and encode/decode strings online for free.developer-toolsweb-developmentsecurityDevamını Oku Base64 Encode and Decode — What It Is and How to Use It
converter4 Nis 2026·3 dk okumaUnit Converter Guide for Project PlanningUse unit conversion to plan projects, specs, measurements, recipes, layouts, shipping, and documentation with fewer avoidable errors.project-planningmeasurementsproductivityDevamını Oku Unit Converter Guide for Project Planning
encoding4 Nis 2026·3 dk okumaHTML Entity Encode Practical Workflow GuideUse HTML Entity Encode for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku HTML Entity Encode Practical Workflow Guide
jwt3 Nis 2026·11 dk okumaJWT Tokens Explained: What They Are and How to Decode ThemUnderstand JSON Web Tokens (JWT) — how they work, their structure, common use cases, security best practices, and how to decode them with free online tools.securityauthenticationdeveloper-toolsDevamını Oku JWT Tokens Explained: What They Are and How to Decode Them
networking3 Nis 2026·3 dk okumaIP Lookup Practical Workflow GuideUse IP Lookup for network debugging workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsdebuggingprivacyDevamını Oku IP Lookup Practical Workflow Guide
pdf3 Nis 2026·2 dk okumaPDF to Excel Guide for Table ExtractionExtract tables from PDFs into spreadsheets for reports, audits, invoices, research, cleanup, and review workflows.table-extractionspreadsheetsproductivityDevamını Oku PDF to Excel Guide for Table Extraction
games3 Nis 2026·3 dk okumaSudoku Solving Techniques for Beginners: From Singles to Smarter ScansLearn beginner-friendly Sudoku solving techniques that help you make progress without guessing.brainstrategyDevamını Oku Sudoku Solving Techniques for Beginners: From Singles to Smarter Scans
html-to-markdown3 Nis 2026·2 dk okumaHTML to Markdown Guide for Content MigrationConvert HTML into Markdown for docs, blog archives, notes, knowledge bases, and cleanup projects with fewer formatting issues.content-migrationdocumentationwritingDevamını Oku HTML to Markdown Guide for Content Migration
ai2 Nis 2026·3 dk okumaAI Logo Maker Guide for Brand Concept ExplorationUse an AI logo maker to explore early brand directions, compare concepts, and prepare cleaner identity ideas before final design work.brandinglogo-designstartup-toolsDevamını Oku AI Logo Maker Guide for Brand Concept Exploration
math-expression2 Nis 2026·3 dk okumaMath Expression Practical Workflow GuideUse Math Expression for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.calculatormathplanningproductivityDevamını Oku Math Expression Practical Workflow Guide
calculator2 Nis 2026·3 dk okumaDate Calculator Guide for Deadline PlanningPlan deadlines, review windows, launch schedules, and follow-up dates with date calculations that account for real working time.deadlinesproject-planningproductivityDevamını Oku Date Calculator Guide for Deadline Planning
pdf2 Nis 2026·2 dk okumaPDF OCR Guide for Scanned DocumentsUse PDF OCR to make scanned documents searchable, extractable, and easier to review for notes, archives, reports, and forms.scanned-documentstext-toolsproductivityDevamını Oku PDF OCR Guide for Scanned Documents
seo1 Nis 2026·11 dk okumaHow to Analyze Your Website SEO, Performance and SecurityLearn how to audit your website's SEO, performance, security, and accessibility. Use free tools to identify issues and improve your site's ranking and speed.website-analysisperformancesecurityDevamını Oku How to Analyze Your Website SEO, Performance and Security
jwt-inspector31 Mar 2026·3 dk okumaJWT Inspector Practical Workflow GuideUse JWT Inspector for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku JWT Inspector Practical Workflow Guide
games31 Mar 2026·3 dk okumaFlip a Coin Practical Workflow GuideUse Flip a Coin for random choice workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.generatorplanningproductivitydecision-makingDevamını Oku Flip a Coin Practical Workflow Guide
image-tools31 Mar 2026·2 dk okumaImage to Text Guide for OCR WorkflowsExtract text from screenshots, scans, receipts, labels, and photos with a cleaner OCR workflow that includes review and cleanup.ocrdata-extractionproductivityDevamını Oku Image to Text Guide for OCR Workflows
sitemap30 Mar 2026·3 dk okumaSitemap Generator Guide for Technical SEOCreate cleaner XML sitemaps for websites, blogs, tools, stores, and documentation so search engines can discover important pages faster.technical-seocrawlingwebsitesDevamını Oku Sitemap Generator Guide for Technical SEO
pdf30 Mar 2026·3 dk okumaPDF to JPG Practical Workflow GuideUse PDF to JPG for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF to JPG Practical Workflow Guide
data-formats30 Mar 2026·3 dk okumaJSON Schema Validator Practical Workflow GuideUse JSON Schema Validator for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku JSON Schema Validator Practical Workflow Guide
encoding30 Mar 2026·3 dk okumaGzip Decompress Practical Workflow GuideUse Gzip Decompress for file decompression workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.compressiondeveloper-toolsfile-toolsworkflowDevamını Oku Gzip Decompress Practical Workflow Guide
database30 Mar 2026·26 dk okumaDatabase Migrations That Won't Destroy Your Weekend: Zero-Downtime Schema ChangesThe hard-won lessons from years of migrating production databases without downtime. Lock contention, expand-contract patterns, online schema tools, ORM pitfalls, and the incident stories nobody talks about.postgresqlmigrationsdevopsbackendDevamını Oku Database Migrations That Won't Destroy Your Weekend: Zero-Downtime Schema Changes
data-formats30 Mar 2026·2 dk okumaJSONPath Finder Guide: Pull the Right Data From API ResponsesLearn how JSONPath helps inspect nested API responses, logs, configs, and datasets without manually searching huge JSON.apideveloper-toolsdatadebuggingDevamını Oku JSONPath Finder Guide: Pull the Right Data From API Responses
text-tools30 Mar 2026·3 dk okumaText to Handwriting Practical Workflow GuideUse Text to Handwriting for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.writingeditingproductivityDevamını Oku Text to Handwriting Practical Workflow Guide
pdf30 Mar 2026·2 dk okumaPDF Page Numbers Guide: Make Long Documents Easier to ReviewAdd page numbers to PDFs for reports, contracts, packets, school submissions, and review documents without confusing readers.documentsproductivitybusinessfree-toolsDevamını Oku PDF Page Numbers Guide: Make Long Documents Easier to Review
social-media30 Mar 2026·26 dk okumaBest Free Meme Makers Online in 2026: Create Viral Memes Without WatermarksMake memes in seconds — custom templates, text overlay, GIF memes, no watermark, no signup. The best free browser-based meme generators for social media.free-toolscreativityonline-toolsentertainmentDevamını Oku Best Free Meme Makers Online in 2026: Create Viral Memes Without Watermarks
pdf29 Mar 2026·3 dk okumaPDF Extract Pages Practical Workflow GuideUse PDF Extract Pages for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Extract Pages Practical Workflow Guide
typescript28 Mar 2026·2 dk okumaJSON to TypeScript Guide: Create Safer API Types From Real PayloadsUse JSON to TypeScript conversion to bootstrap API types, then refine optional fields, arrays, unions, and runtime validation.data-formatsapideveloper-toolsprogrammingDevamını Oku JSON to TypeScript Guide: Create Safer API Types From Real Payloads
audio28 Mar 2026·2 dk okumaAudio Converter Guide for Format CompatibilityConvert audio files for podcasts, videos, archives, transcription, and sharing while balancing compatibility, size, and quality.media-workflowcontent-creationDevamını Oku Audio Converter Guide for Format Compatibility
open-source28 Mar 2026·9 dk okumaBest Open Source Alternatives to Expensive Software in 2026Save thousands with the best open source alternatives to popular paid software. 650+ vetted alternatives for design, development, productivity, and more.free-toolsalternativesproductivityDevamını Oku Best Open Source Alternatives to Expensive Software in 2026
image-tools27 Mar 2026·3 dk okumaJPG to WebP Practical Workflow GuideUse JPG to WebP for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku JPG to WebP Practical Workflow Guide
pdf27 Mar 2026·2 dk okumaExcel to PDF Guide for Spreadsheet SharingConvert spreadsheets to PDFs for reports, invoices, schedules, budgets, dashboards, and review packets with cleaner layout control.spreadsheet-sharingreportsproductivityDevamını Oku Excel to PDF Guide for Spreadsheet Sharing
networking27 Mar 2026·2 dk okumaDomain Name Generator Guide: Choose a Domain People Can RememberFind better domain names for startups, projects, portfolios, and products with practical checks for clarity and trust.businessbrandinggeneratorseoDevamını Oku Domain Name Generator Guide: Choose a Domain People Can Remember
calculator27 Mar 2026·3 dk okumaPercentage Operations Practical Workflow GuideUse Percentage Operations for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.mathplanningproductivityDevamını Oku Percentage Operations Practical Workflow Guide
video27 Mar 2026·27 dk okumaBest Free Screen Recorders in 2026: Record Your Screen Without Downloading AnythingRecord your screen, webcam, or both — directly in your browser. No software to install, no watermarks, no time limits. The best free screen recording tools of 2026.free-toolsproductivitycontent-creationonline-toolsDevamını Oku Best Free Screen Recorders in 2026: Record Your Screen Without Downloading Anything
flowcharts26 Mar 2026·4 dk okumaFlowchart Maker Guide for Clear Process DocumentationDocument business, product, and support workflows with flowcharts that make decisions, handoffs, and edge cases easier to understand.documentationoperationsproductivityDevamını Oku Flowchart Maker Guide for Clear Process Documentation
ai26 Mar 2026·2 dk okumaAI Object Remover Guide for Photo CleanupRemove unwanted objects from photos for cleaner listings, social posts, presentations, albums, and design drafts with careful review.image-toolsvisual-contentDevamını Oku AI Object Remover Guide for Photo Cleanup
devops26 Mar 2026·3 dk okumaCron Expression Generator Guide: Schedule Jobs Without GuessingUnderstand cron expressions, common schedules, timezone risks, and safe workflows for background jobs and automations.cronautomationdeveloper-toolsworkflowDevamını Oku Cron Expression Generator Guide: Schedule Jobs Without Guessing
pdf26 Mar 2026·22 dk okumaBest Free PDF Editor Online in 2026: Edit, Merge, Split & Sign Without SoftwareStop paying for Adobe Acrobat. These free browser-based PDF editors let you edit text, merge files, compress, split, add signatures, and convert — no download required.free-toolsproductivityonline-toolsdocument-editingDevamını Oku Best Free PDF Editor Online in 2026: Edit, Merge, Split & Sign Without Software
video26 Mar 2026·36 dk okumaBest Free Online Video Editors in 2026: Edit Videos Without Downloading SoftwarePremiere Pro costs $23/month. These free browser-based video editors handle trimming, cutting, merging, effects, and subtitles — no download, no watermark.free-toolscontent-creationonline-toolssocial-mediaDevamını Oku Best Free Online Video Editors in 2026: Edit Videos Without Downloading Software
font-preview26 Mar 2026·3 dk okumaFont Preview Practical Workflow GuideUse Font Preview for front-end design workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.cssdesignfrontendworkflowDevamını Oku Font Preview Practical Workflow Guide
image-tools26 Mar 2026·3 dk okumaImage Watermark Practical Workflow GuideUse Image Watermark for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku Image Watermark Practical Workflow Guide
color25 Mar 2026·3 dk okumaColor Mixer Guide for Palette ExperimentsUse color mixing to explore tints, blends, accents, and palette transitions before committing values to a brand or interface system.brandingui-designDevamını Oku Color Mixer Guide for Palette Experiments
frequency-counter25 Mar 2026·3 dk okumaFrequency Counter Practical Workflow GuideUse Frequency Counter for text workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.textworkflowproductivityonline-toolsDevamını Oku Frequency Counter Practical Workflow Guide
data-formats25 Mar 2026·2 dk okumaTOML Converter Guide for Config MigrationConvert TOML configuration files during tooling changes, audits, and migrations while preserving types, tables, arrays, and comments.configurationmigrationdeveloper-toolsDevamını Oku TOML Converter Guide for Config Migration
pdf25 Mar 2026·3 dk okumaPDF Bookmarks Practical Workflow GuideUse PDF Bookmarks for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Bookmarks Practical Workflow Guide
pdf25 Mar 2026·3 dk okumaGIF to PDF Practical Workflow GuideUse GIF to PDF for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku GIF to PDF Practical Workflow Guide
converter25 Mar 2026·3 dk okumaRoman Numeral Converter Practical Workflow GuideUse Roman Numeral Converter for converter workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.workflowproductivityonline-toolsDevamını Oku Roman Numeral Converter Practical Workflow Guide
countdown-timer24 Mar 2026·3 dk okumaCountdown Timer Practical Workflow GuideUse Countdown Timer for time planning workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.time-toolsplanningproductivityschedulingDevamını Oku Countdown Timer Practical Workflow Guide
image-tools24 Mar 2026·2 dk okumaImage Vectorizer Guide for Logo CleanupConvert raster logos and simple graphics into vector-style assets for cleaner scaling, editing, print, and brand documentation.logo-cleanupsvgbrandingDevamını Oku Image Vectorizer Guide for Logo Cleanup
generator24 Mar 2026·3 dk okumaRandom Word Generator Practical Workflow GuideUse Random Word Generator for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Random Word Generator Practical Workflow Guide
open-source24 Mar 2026·13 dk okumaBest Open Source Alternatives to Paid Software 2026 — Save Money, Keep ControlReplace expensive software with powerful open source alternatives. From Photoshop to Office to Slack — find free, open source tools that match or beat paid options.toolsproductivityDevamını Oku Best Open Source Alternatives to Paid Software 2026 — Save Money, Keep Control
cron-parser24 Mar 2026·3 dk okumaCron Parser Practical Workflow GuideUse Cron Parser for time planning workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.time-toolsplanningproductivityschedulingDevamını Oku Cron Parser Practical Workflow Guide
ascii-table24 Mar 2026·3 dk okumaASCII Table Practical Workflow GuideUse ASCII Table for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku ASCII Table Practical Workflow Guide
data-formats24 Mar 2026·2 dk okumaJSON Path Finder Guide for Nested DataFind paths inside nested JSON for reports, API review, automation, documentation, testing, and data extraction.apidata-extractionDevamını Oku JSON Path Finder Guide for Nested Data
generator24 Mar 2026·2 dk okumaCertificate Generator Guide for Event RecognitionCreate certificates for workshops, courses, events, teams, and awards with clearer names, dates, branding, and export practices.eventseducationrecognitionDevamını Oku Certificate Generator Guide for Event Recognition
javascript23 Mar 2026·3 dk okumaJavaScript Minifier Guide for Performance and DeploymentMinify JavaScript for smaller production assets while preserving source readability, debugging workflows, and safe release practices.minificationweb-performancedeploymentDevamını Oku JavaScript Minifier Guide for Performance and Deployment
open-source23 Mar 2026·10 dk okumaBest Open Source Alternatives to Popular Software in 2026Discover 650+ open source alternatives to popular commercial software. Save money without sacrificing quality with these free, community-driven tools.alternativesfree-tools2026Devamını Oku Best Open Source Alternatives to Popular Software in 2026
generator23 Mar 2026·2 dk okumaRandom Number Generator Guide for Fair SelectionUse a random number generator for fair picks, classroom activities, giveaways, simulations, lists, and simple decision workflows.fair-selectioneducationproductivityDevamını Oku Random Number Generator Guide for Fair Selection
design23 Mar 2026·15 dk okumaHow to Make YouTube Thumbnails That Get Clicks — Free Tools and Design TipsYour thumbnail is 90% of whether someone clicks. Here's the design psychology, sizing rules, and free tools to create thumbnails that actually drive views.youtubeimage-toolsfree-toolsmarketingDevamını Oku How to Make YouTube Thumbnails That Get Clicks — Free Tools and Design Tips
password-security23 Mar 2026·3 dk okumaPassword Strength Checker Guide for Better Security HabitsUse password strength checks to improve everyday security habits without relying on misleading complexity rules or reused credentials.privacysecuritypersonal-dataDevamını Oku Password Strength Checker Guide for Better Security Habits
design23 Mar 2026·30 dk okumaHow to Identify Any Font from an Image: Free Font Finder Tools in 2026Spotted a beautiful font but don't know its name? These free tools identify fonts from screenshots, photos, and websites instantly — plus where to download them.fontsfree-toolstypographyonline-toolsDevamını Oku How to Identify Any Font from an Image: Free Font Finder Tools in 2026
data-formats23 Mar 2026·2 dk okumaTSV to JSON Guide for Spreadsheet ExportsConvert tab-separated spreadsheet exports into JSON for scripts, imports, audits, and automation while preserving clean rows and headers.spreadsheetsconverterDevamını Oku TSV to JSON Guide for Spreadsheet Exports
text-tools22 Mar 2026·2 dk okumaHandwriting to Text Guide for Notes DigitizationConvert handwritten notes into editable text for study, meetings, research, and archives with better capture, review, and organization.notesocrproductivityDevamını Oku Handwriting to Text Guide for Notes Digitization
oauth22 Mar 2026·33 dk okumaOAuth 2.1 and OpenID Connect: The Parts That Actually Confuse EveryoneA no-nonsense deep dive into OAuth 2.1 and OpenID Connect. Authorization Code + PKCE with real HTTP requests, token storage wars, refresh token rotation, OIDC discovery, multi-tenant identity, and the vulnerabilities that bite even experienced teams.authenticationsecurityopenid-connectbackendDevamını Oku OAuth 2.1 and OpenID Connect: The Parts That Actually Confuse Everyone
tools22 Mar 2026·14 dk okumaBest Free File Converter Online 2026 — Convert Any File Format InstantlyConvert documents, images, audio, video, and data files between any format online for free. No software to install — compare the fastest and most reliable converters.converterproductivityDevamını Oku Best Free File Converter Online 2026 — Convert Any File Format Instantly
image-tools22 Mar 2026·5 dk okumaImage Compression for SEO: Faster Pages Without Ugly PhotosA practical image compression guide for SEO, Core Web Vitals, ecommerce pages, blogs, and landing pages.seoperformanceweb-developmentfree-toolsDevamını Oku Image Compression for SEO: Faster Pages Without Ugly Photos
pdf20 Mar 2026·19 dk okumaHow to Edit PDFs Online for Free — The Complete Guide (2026)Learn how to edit, merge, split, compress, and convert PDFs online without paying a cent. Step-by-step instructions for every common PDF task.free-toolsonline-toolsproductivityconverterDevamını Oku How to Edit PDFs Online for Free — The Complete Guide (2026)
pdf20 Mar 2026·2 dk okumaPDF Rotate Guide for Scan CleanupRotate PDF pages for cleaner scans, forms, receipts, worksheets, applications, reports, and mixed-orientation document packets.scan-cleanupdocumentsproductivityDevamını Oku PDF Rotate Guide for Scan Cleanup
encoding20 Mar 2026·3 dk okumaAdler-32 Practical Workflow GuideUse Adler-32 for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Adler-32 Practical Workflow Guide
pdf20 Mar 2026·28 dk okumaHow to Compress PDF Files Without Losing Quality: Free Methods That Actually WorkThat 45MB PDF won't attach to your email. Here's how to shrink PDF files by 80% while keeping text sharp and images clear — free, no software needed.free-toolsproductivityfile-compressiononline-toolsDevamını Oku How to Compress PDF Files Without Losing Quality: Free Methods That Actually Work
pdf20 Mar 2026·2 dk okumaPDF Signature Guide: Sign Documents Clearly and Share Them SafelyUnderstand PDF signing workflows, signature images, digital signatures, document review, and common mistakes before sending signed files.signaturedocumentssecuritybusinessDevamını Oku PDF Signature Guide: Sign Documents Clearly and Share Them Safely
developer-tools20 Mar 2026·3 dk okumaCode Beautifier Workflow: Format Messy Code Before You Debug ItUse a code beautifier to make messy JavaScript, CSS, HTML, JSON, and snippets easier to review, debug, and share.codeformattingdebuggingprogrammingDevamını Oku Code Beautifier Workflow: Format Messy Code Before You Debug It
barcodes19 Mar 2026·3 dk okumaBarcode Generator Guide for Inventory LabelsCreate practical barcode labels for inventory, events, retail, and internal tracking with readable codes and cleaner label workflows.inventorylabelsoperationsDevamını Oku Barcode Generator Guide for Inventory Labels
calculator19 Mar 2026·3 dk okumaPrime Factorization Practical Workflow GuideUse Prime Factorization for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.mathplanningproductivityDevamını Oku Prime Factorization Practical Workflow Guide
calculator19 Mar 2026·3 dk okumaNumber Sequence Practical Workflow GuideUse Number Sequence for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.mathplanningproductivityDevamını Oku Number Sequence Practical Workflow Guide
pixel-art-editor19 Mar 2026·3 dk okumaPixel Art Editor Practical Workflow GuideUse Pixel Art Editor for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.image-toolsdesignworkflowmediaDevamını Oku Pixel Art Editor Practical Workflow Guide
games18 Mar 2026·12 dk okuma50+ Free Online Games You Can Play in Your BrowserDiscover 50+ free online games you can play directly in your browser with no downloads or installs. From puzzles to strategy games, find your next favorite.Devamını Oku 50+ Free Online Games You Can Play in Your Browser
networking18 Mar 2026·30 dk okumaWebSockets at Scale: Architecture, Reconnection, and the Mistakes I Keep SeeingEverything I learned building real-time features with WebSockets. Connection management, scaling beyond one server, heartbeats, reconnection strategies, and why most tutorials skip the hard parts.real-timenode.jsarchitecturescalingDevamını Oku WebSockets at Scale: Architecture, Reconnection, and the Mistakes I Keep Seeing
encoding17 Mar 2026·3 dk okumaCharcode to String Practical Workflow GuideUse Charcode to String for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Charcode to String Practical Workflow Guide
ai17 Mar 2026·2 dk okumaAI Chatbot Guide for Support DraftsUse an AI chatbot to draft support replies, FAQs, troubleshooting steps, and customer explanations with safer review habits.customer-supportwritingproductivityDevamını Oku AI Chatbot Guide for Support Drafts
calculator17 Mar 2026·3 dk okumaMatrix Operations Practical Workflow GuideUse Matrix Operations for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.mathplanningproductivityDevamını Oku Matrix Operations Practical Workflow Guide
encoding17 Mar 2026·3 dk okumaBinary String Converter Practical Workflow GuideUse Binary String Converter for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Binary String Converter Practical Workflow Guide
html17 Mar 2026·2 dk okumaHTML Escape Guide: Prevent Broken Markup and Safer Text RenderingLearn when to escape HTML, how entities work, and why safe text rendering matters for forms, comments, previews, and templates.securityweb-developmentdeveloper-toolstextDevamını Oku HTML Escape Guide: Prevent Broken Markup and Safer Text Rendering
data-formats17 Mar 2026·2 dk okumaINI Converter Guide for Legacy Config CleanupConvert and review INI configuration files from legacy systems while keeping sections, keys, comments, and defaults understandable.configurationlegacy-systemsdeveloper-toolsDevamını Oku INI Converter Guide for Legacy Config Cleanup
converter17 Mar 2026·3 dk okumaData Size Converter Practical Workflow GuideUse Data Size Converter for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsproductivityDevamını Oku Data Size Converter Practical Workflow Guide
gif-maker17 Mar 2026·3 dk okumaGIF Maker Guide for Clean Looping AnimationsTurn clips, screen recordings, product moments, and reactions into cleaner GIFs with better loops, captions, size, and clarity.animationsocial-mediacontent-workflowDevamını Oku GIF Maker Guide for Clean Looping Animations
writing17 Mar 2026·32 dk okumaBest Free Online Text Tools for Writers in 2026: Word Count, Grammar, Formatting, and MoreWord counters, case converters, text comparers, grammar checkers, readability analyzers — the free browser tools every writer needs. No signups, no subscriptions.text-toolsfree-toolsproductivityonline-toolsDevamını Oku Best Free Online Text Tools for Writers in 2026: Word Count, Grammar, Formatting, and More
pdf16 Mar 2026·2 dk okumaPDF OCR Guide: Make Scanned Documents Searchable and EditableLearn how PDF OCR works, when to use it, how to improve scan quality, and what to check after recognizing text.ocrdocumentsproductivityfree-toolsDevamını Oku PDF OCR Guide: Make Scanned Documents Searchable and Editable
image-tools16 Mar 2026·17 dk okumaRemove Image Backgrounds for Free: No Photoshop, No Uploads, No LimitsAI-powered background removal now runs entirely in your browser. No file uploads, no per-image fees, no watermarks — just drag, drop, and download.aifree-toolsdesignproductivityDevamını Oku Remove Image Backgrounds for Free: No Photoshop, No Uploads, No Limits
image-tools16 Mar 2026·3 dk okumaSVG to CSS Practical Workflow GuideUse SVG to CSS for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku SVG to CSS Practical Workflow Guide
data-formats16 Mar 2026·3 dk okumaCSV to JSON Converter Guide for Cleaner Data HandoffsConvert CSV to JSON more reliably by preparing headers, handling types, cleaning rows, and checking structure before sharing data.data-cleanupdeveloper-toolsDevamını Oku CSV to JSON Converter Guide for Cleaner Data Handoffs
screen-resolution-checker15 Mar 2026·3 dk okumaScreen Resolution Checker Practical Workflow GuideUse Screen Resolution Checker for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Screen Resolution Checker Practical Workflow Guide
ai15 Mar 2026·32 dk okumaLLMs in Production Web Apps: Streaming, Caching, Cost Control, and What the Tutorials SkipThe real engineering behind integrating large language models into web applications. Streaming responses, managing costs, handling failures, prompt management, caching strategies, and building AI features users actually want.llmweb-developmentstreamingarchitectureDevamını Oku LLMs in Production Web Apps: Streaming, Caching, Cost Control, and What the Tutorials Skip
games14 Mar 2026·3 dk okumaTournament Bracket Practical Workflow GuideUse Tournament Bracket for generator workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.generatorworkflowproductivityonline-toolsDevamını Oku Tournament Bracket Practical Workflow Guide
data-formats14 Mar 2026·3 dk okumaData URI Handler Practical Workflow GuideUse Data URI Handler for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku Data URI Handler Practical Workflow Guide
networking14 Mar 2026·2 dk okumaURL Builder Guide for Campaign TrackingBuild campaign URLs with consistent parameters for email, social, paid, partner, and offline campaigns without corrupting analytics.campaign-trackinganalyticsmarketingDevamını Oku URL Builder Guide for Campaign Tracking
tools13 Mar 2026·14 dk okumaEncode & Decode Base64, JWT, URL & HTML Online Free — Developer Tools GuideEncode and decode Base64, JWT tokens, URLs, and HTML entities online for free. Understand when and why to use each encoding — with practical examples.web-developmentdeveloperDevamını Oku Encode & Decode Base64, JWT, URL & HTML Online Free — Developer Tools Guide
pdf12 Mar 2026·2 dk okumaPDF Watermark Guide for Document BrandingAdd PDF watermarks for drafts, samples, client review, internal copies, branded packets, and document status labels.document-brandingclient-reviewproductivityDevamını Oku PDF Watermark Guide for Document Branding
encoding12 Mar 2026·3 dk okumaMD5 Hash Generator Practical Workflow GuideUse MD5 Hash Generator for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku MD5 Hash Generator Practical Workflow Guide
pdf12 Mar 2026·3 dk okumaPDF N-Up Practical Workflow GuideUse PDF N-Up for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF N-Up Practical Workflow Guide
developer-tools12 Mar 2026·2 dk okumaURL Encoder and Decoder Guide: Build Safer Query StringsUnderstand URL encoding, decoding, query strings, reserved characters, and common bugs in links, APIs, and redirects.networkingencodingapiweb-developmentDevamını Oku URL Encoder and Decoder Guide: Build Safer Query Strings
writing12 Mar 2026·2 dk okumaBook Title Generator Guide for Creative WritingUse a book title generator to brainstorm stronger fiction, nonfiction, essay, course, newsletter, and project titles.titlespublishingDevamını Oku Book Title Generator Guide for Creative Writing
image-tools12 Mar 2026·3 dk okumaPoster Maker Guide for Event PromotionCreate clearer posters for events, launches, workshops, classes, and local promotions with stronger hierarchy and export choices.event-promotiondesignmarketingDevamını Oku Poster Maker Guide for Event Promotion
open-source12 Mar 2026·19 dk okumaTop 20 Open Source Alternatives to Popular Paid Software in 2026Save money with the best open source alternatives to Photoshop, Slack, Notion, and more. Free, community-driven software that rivals paid tools in 2026.free-toolsalternativesproductivitysoftwareDevamını Oku Top 20 Open Source Alternatives to Popular Paid Software in 2026
calculator12 Mar 2026·3 dk okumaElectricity Calculator Practical Workflow GuideUse Electricity Calculator for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.mathplanningproductivityDevamını Oku Electricity Calculator Practical Workflow Guide
seo12 Mar 2026·15 dk okumaSEO Is Not Enough Anymore: A Developer's Guide to Generative Engine OptimizationTraditional SEO gets you ranked. GEO gets you cited by AI. Here's how to optimize your site for both Google and AI-powered search engines like ChatGPT, Perplexity, and Google AI Overviews — with code examples.aiweb-developmentnext.jsarchitectureDevamını Oku SEO Is Not Enough Anymore: A Developer's Guide to Generative Engine Optimization
text-tools11 Mar 2026·3 dk okumaLine Sorter Practical Workflow GuideUse Line Sorter for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.writingeditingproductivityDevamını Oku Line Sorter Practical Workflow Guide
generator11 Mar 2026·2 dk okumaRandom Quote Generator Guide for Content IdeasUse random quotes as prompts for newsletters, journals, classrooms, social posts, writing practice, and creative brainstorming.content-ideaswritingcreativityDevamını Oku Random Quote Generator Guide for Content Ideas
programming11 Mar 2026·4 dk okumaFree Online Code Playground for Teaching: Run Examples Without SetupUse an online code playground to teach programming, share examples, reduce setup friction, and help beginners run code faster.educationdeveloper-toolsfree-toolsDevamını Oku Free Online Code Playground for Teaching: Run Examples Without Setup
converter11 Mar 2026·9 dk okumaFree Online Unit Converters: 200+ Conversion ToolsConvert between units of length, weight, temperature, volume, speed, and 200+ more categories. Free, instant, and accurate online unit converters.free-toolsmathreferenceDevamını Oku Free Online Unit Converters: 200+ Conversion Tools
rust10 Mar 2026·31 dk okumaRust for JavaScript Developers: The Mental Model Shift That Changes EverythingA JavaScript developer's honest journey into Rust. Ownership, borrowing, lifetimes explained through the lens of someone who thinks in closures and callbacks. What clicked, what didn't, and why Rust made me a better JS developer.javascriptsystems-programminglearningperformanceDevamını Oku Rust for JavaScript Developers: The Mental Model Shift That Changes Everything
extract-emails9 Mar 2026·3 dk okumaExtract Emails Practical Workflow GuideUse Extract Emails for safe inspection workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsinspectionprivacyworkflowDevamını Oku Extract Emails Practical Workflow Guide
online-notepad9 Mar 2026·2 dk okumaOnline Notepad Guide for Better Meeting NotesUse an online notepad to capture cleaner meeting notes, action items, decisions, interview points, and follow-up summaries.meeting-notesproductivitywritingDevamını Oku Online Notepad Guide for Better Meeting Notes
pdf9 Mar 2026·4 dk okumaPDF to Word Conversion: How to Get Clean, Editable DocumentsLearn how PDF to Word conversion works, why formatting breaks, and how to get cleaner editable documents from PDFs.converterdocumentswordfree-toolsDevamını Oku PDF to Word Conversion: How to Get Clean, Editable Documents
color9 Mar 2026·3 dk okumaColor Converter Guide for Design HandoffConvert color values between hex, RGB, HSL, and other formats so design specs, CSS, brand files, and documentation stay aligned.design-handofffrontendweb-designDevamını Oku Color Converter Guide for Design Handoff
pdf9 Mar 2026·3 dk okumaPDF Compress Guide for Email and Upload LimitsCompress PDFs for email, portals, applications, and archives while keeping text, scans, signatures, and images readable.file-sizedocumentsproductivityDevamını Oku PDF Compress Guide for Email and Upload Limits
education9 Mar 2026·2 dk okumaQuiz Maker Guide for Training and AssessmentCreate quizzes for classes, onboarding, workshops, and training programs that measure understanding instead of only memorization.trainingDevamını Oku Quiz Maker Guide for Training and Assessment
color9 Mar 2026·3 dk okumaColor Name Finder Guide for Design CommunicationUse color names to communicate palettes, brand directions, and design feedback more clearly without replacing exact color values.design-communicationbrandingweb-designDevamını Oku Color Name Finder Guide for Design Communication
image-tools8 Mar 2026·10 dk okumaFree Online Photo Editor: Professional Editing Without DownloadsEdit photos like a pro with our free online photo editor. Layers, filters, AI tools, HDR, templates, and more — Photoshop-level editing right in your browser.free-toolsdesignphotographyDevamını Oku Free Online Photo Editor: Professional Editing Without Downloads
image-tools8 Mar 2026·30 dk okumaHow to Crop, Rotate, and Flip Images Online for Free: Quick Guide for Any DeviceCrop to exact dimensions, rotate any angle, flip horizontally or vertically — all free, in your browser, on any device. No app download, no account needed.free-toolsproductivityonline-toolssocial-mediaDevamını Oku How to Crop, Rotate, and Flip Images Online for Free: Quick Guide for Any Device
email-extractor7 Mar 2026·2 dk okumaEmail Extractor Guide for Contact List CleanupExtract email addresses from messy text, documents, exports, and notes, then clean, validate, deduplicate, and organize them responsibly.contact-listsdata-cleanupproductivityDevamını Oku Email Extractor Guide for Contact List Cleanup
image-tools7 Mar 2026·3 dk okumaSticker Maker Guide for Community PacksDesign clearer sticker packs for communities, chats, launches, classrooms, and creator brands with stronger expression and consistency.communityvisual-designcreator-toolsDevamını Oku Sticker Maker Guide for Community Packs
video6 Mar 2026·2 dk okumaVideo Trimmer Guide for Short-Form ContentTrim videos into tighter social clips, tutorials, demos, and highlights by cutting dead air, setup time, repeated takes, and weak endings.content-creationsocial-mediaDevamını Oku Video Trimmer Guide for Short-Form Content
ai6 Mar 2026·2 dk okumaAI Room Designer Guide for Renovation PlanningUse an AI room designer for layout ideas, color exploration, furniture planning, mood boards, and renovation conversations.interior-designrenovation-planninghome-projectsDevamını Oku AI Room Designer Guide for Renovation Planning
converter6 Mar 2026·23 dk okumaHow to Convert Images Between PNG, JPG, WebP, SVG, and More: Free Online GuidePNG to JPG, WebP to PNG, SVG to PNG, HEIC to JPG — convert any image format to any other format for free, instantly, in your browser. No software needed.image-toolsfree-toolsonline-toolsweb-developmentDevamını Oku How to Convert Images Between PNG, JPG, WebP, SVG, and More: Free Online Guide
encoding6 Mar 2026·3 dk okumaBinary Text Practical Workflow GuideUse Binary Text for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Binary Text Practical Workflow Guide
ai6 Mar 2026·2 dk okumaAI Writer Guide for Blog Draft WorkflowsUse an AI writer for blog outlines, drafts, rewrites, summaries, and editing while keeping human judgment and originality in control.writingcontent-workfloweditingDevamını Oku AI Writer Guide for Blog Draft Workflows
encoding6 Mar 2026·3 dk okumaByte Frequency Practical Workflow GuideUse Byte Frequency for safe inspection workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsinspectionprivacyworkflowDevamını Oku Byte Frequency Practical Workflow Guide
authentication5 Mar 2026·35 dk okumaAuthentication in 2026: Sessions vs JWTs, OAuth Flows, and the Security Tradeoffs Nobody ExplainsA deep dive into authentication patterns for web applications. Why JWTs aren't always the answer, when sessions still win, OAuth 2.0 flows demystified, refresh token rotation, and the security mistakes I see in almost every codebase.securityoauthjwtweb-developmentDevamını Oku Authentication in 2026: Sessions vs JWTs, OAuth Flows, and the Security Tradeoffs Nobody Explains
audio5 Mar 2026·2 dk okumaAudio Visualizer Guide for Music and Voice ContentCreate audio visualizers for music, podcasts, voice clips, and social posts with cleaner motion, branding, and export choices.videocreative-workflowDevamını Oku Audio Visualizer Guide for Music and Voice Content
audio5 Mar 2026·3 dk okumaText to Speech Practical Workflow GuideUse Text to Speech for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Text to Speech Practical Workflow Guide
audio5 Mar 2026·2 dk okumaAudio Trimmer Guide for Podcast and Voice EditingTrim audio recordings for podcasts, interviews, lessons, voice notes, and clips by removing silence, mistakes, and weak endings.content-creationDevamını Oku Audio Trimmer Guide for Podcast and Voice Editing
encoding5 Mar 2026·3 dk okumaCRC32 Practical Workflow GuideUse CRC32 for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku CRC32 Practical Workflow Guide
link-in-bio5 Mar 2026·2 dk okumaLink in Bio Generator Guide for Creator HubsBuild a focused link-in-bio page for creators, brands, events, and small businesses without turning it into a cluttered link dump.creatorssocial-mediamarketingDevamını Oku Link in Bio Generator Guide for Creator Hubs
web35 Mar 2026·11 dk okumaÜretimde Zincir Üstü Veri: Kimsenin Size Söylemediği ŞeylerBlok zinciri verisi temiz, güvenilir veya kolay değildir. RPC hız limitleri, zincir yeniden düzenlemeleri, BigInt hataları ve indeksleme ödünleşimleri — gerçek DeFi ürünleri gönderirken öğrenilen zor dersler.blockchaintypescriptdefiethereumDevamını Oku Üretimde Zincir Üstü Veri: Kimsenin Size Söylemediği Şeyler
tools4 Mar 2026·15 dk okumaConvert Audio Files Free Online — MP3, WAV, OGG, FLAC & MoreConvert between MP3, WAV, OGG, FLAC, AAC and other audio formats online for free. No software needed — understand audio codecs, bitrates, and quality tradeoffs.converteraudioDevamını Oku Convert Audio Files Free Online — MP3, WAV, OGG, FLAC & More
code-beautifier4 Mar 2026·3 dk okumaCode Beautifier Guide for Review and CleanupUse code beautification to make snippets, examples, configs, and pasted code easier to review without changing the underlying logic.developer-toolscode-reviewformattingDevamını Oku Code Beautifier Guide for Review and Cleanup
data-formats4 Mar 2026·3 dk okumaJSON Flatten Practical Workflow GuideUse JSON Flatten for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku JSON Flatten Practical Workflow Guide
converter4 Mar 2026·2 dk okumaUnit Converter Guide for Travel and StudyConvert units more confidently for travel, school, cooking, shipping, projects, measurements, and everyday planning.measurementstraveleducationDevamını Oku Unit Converter Guide for Travel and Study
encoding4 Mar 2026·3 dk okumaCRC16 Practical Workflow GuideUse CRC16 for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku CRC16 Practical Workflow Guide
api4 Mar 2026·11 dk okumaAPI Testing Made Easy: Free Tools and Best PracticesLearn API testing fundamentals with free online tools. Master REST API testing, HTTP methods, status codes, headers, authentication, and debugging techniques.testingdeveloper-toolsweb-developmentDevamını Oku API Testing Made Easy: Free Tools and Best Practices
image-tools4 Mar 2026·3 dk okumaJPG to PNG Guide for Graphic WorkflowsConvert JPG images to PNG for editing, screenshots, layout work, documentation, and cases where repeated JPG export is risky.graphic-workflowdesign-assetsDevamını Oku JPG to PNG Guide for Graphic Workflows
security4 Mar 2026·4 dk okumaPassword Generator Guide: Strong Passwords, Passphrases, and Safer DefaultsLearn how to use password generators well, when to choose passphrases, and what safer password defaults look like.passwordprivacyfree-toolsDevamını Oku Password Generator Guide: Strong Passwords, Passphrases, and Safer Defaults
html-to-jsx4 Mar 2026·3 dk okumaHTML to JSX Practical Workflow GuideUse HTML to JSX for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku HTML to JSX Practical Workflow Guide
mind-maps4 Mar 2026·4 dk okumaMind Map Maker Guide for Smarter Study PlanningUse mind maps to organize study topics, connect ideas, identify weak areas, and build a practical review plan before exams.educationproductivityDevamını Oku Mind Map Maker Guide for Smarter Study Planning
authentication4 Mar 2026·25 dk okuma2026'da Modern Kimlik Doğrulama: JWT, Session, OAuth ve PasskeyTam kimlik doğrulama manzarası: session vs JWT ne zaman kullanılır, OAuth 2.0/OIDC akışları, refresh token rotasyonu, passkey'ler (WebAuthn) ve Next.js'te gerçekten kullandığım auth kalıpları.securitynext.jsweb-developmentbackendDevamını Oku 2026'da Modern Kimlik Doğrulama: JWT, Session, OAuth ve Passkey
data-formats3 Mar 2026·3 dk okumaQuery String Parser Practical Workflow GuideUse Query String Parser for network debugging workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.networkingdeveloper-toolsdebuggingprivacyDevamını Oku Query String Parser Practical Workflow Guide
api3 Mar 2026·5 dk okumaAPI Tester vs Postman: A Browser-First Workflow for Fast API DebuggingCompare browser-based API testing with desktop API clients, and learn a practical workflow for debugging REST endpoints faster.developer-toolstestingdebuggingfree-toolsDevamını Oku API Tester vs Postman: A Browser-First Workflow for Fast API Debugging
encoding3 Mar 2026·3 dk okumaPunycode Encode Practical Workflow GuideUse Punycode Encode for converter workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.converterworkflowproductivityonline-toolsDevamını Oku Punycode Encode Practical Workflow Guide
pomodoro3 Mar 2026·4 dk okumaPomodoro Timer Guide for More Reliable Deep WorkUse Pomodoro sessions to start deep work, reduce avoidance, manage breaks, and create a sustainable focus rhythm for demanding tasks.deep-workproductivityfocusDevamını Oku Pomodoro Timer Guide for More Reliable Deep Work
text-tools3 Mar 2026·3 dk okumaLine Sort Practical Workflow GuideUse Line Sort for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.writingeditingproductivityDevamını Oku Line Sort Practical Workflow Guide
css3 Mar 2026·20 dk okuma2026'da Modern CSS: Stil Yazma Şeklimi Değiştiren ÖzelliklerContainer query, CSS layer, :has(), color-mix(), nesting, scroll-driven animasyon ve anchor positioning. JavaScript'e uzanmayı bıraktıran CSS özellikleri.web-developmentfrontenddesignDevamını Oku 2026'da Modern CSS: Stil Yazma Şeklimi Değiştiren Özellikler
video2 Mar 2026·3 dk okumaScreen Recorder Checklist: Make Tutorial Videos People Can FollowPlan, record, and polish screen recordings for tutorials, demos, bug reports, onboarding, and product walkthroughs.educationproductivityfree-toolsDevamını Oku Screen Recorder Checklist: Make Tutorial Videos People Can Follow
pdf2 Mar 2026·3 dk okumaPDF to Markdown Practical Workflow GuideUse PDF to Markdown for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF to Markdown Practical Workflow Guide
video2 Mar 2026·2 dk okumaVideo to GIF Converter Guide for Social SnippetsConvert short video moments into GIFs for social posts, documentation, product updates, and support replies without oversized files.gifssocial-mediaproduct-demosDevamını Oku Video to GIF Converter Guide for Social Snippets
ethereum2 Mar 2026·24 dk okumaWeb Geliştiriciler İçin Ethereum: Abartı Olmadan Smart ContractHer web geliştiricinin bilmesi gereken Ethereum kavramları: hesaplar, transaction'lar, smart contract'lar, ABI encoding, ethers.js, WAGMI ve kendi node'unu çalıştırmadan on-chain veri okuma.web3blockchaintypescriptweb-developmentDevamını Oku Web Geliştiriciler İçin Ethereum: Abartı Olmadan Smart Contract
games1 Mar 2026·35 dk okumaBest Free Brain Training Games Online in 2026: Sharpen Your Mind Without Paying a CentLumosity charges $70/year. These free browser-based brain games offer puzzles, strategy, word challenges, and logic training — no subscription, no app download.brain-trainingeducationDevamını Oku Best Free Brain Training Games Online in 2026: Sharpen Your Mind Without Paying a Cent
pdf1 Mar 2026·3 dk okumaPDF Grayscale Practical Workflow GuideUse PDF Grayscale for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Grayscale Practical Workflow Guide
gaming1 Mar 2026·27 dk okumaPlay Sudoku Online Free: Beginner to Expert Strategies That Actually WorkSudoku isn't just about filling in numbers. Master these strategies — from naked singles to X-Wing — and you'll solve expert puzzles in minutes, not hours.gamesbrain-trainingfree-toolsDevamını Oku Play Sudoku Online Free: Beginner to Expert Strategies That Actually Work
kubernetes28 Şub 2026·30 dk okumaKubernetes for App Developers: Cut Through the ComplexityKubernetes explained for developers who just want to deploy their apps. No cluster admin deep dives. Pods, services, deployments, config maps, health checks, and the debugging workflow that actually works.devopscontainersdeploymentcloudDevamını Oku Kubernetes for App Developers: Cut Through the Complexity
tailwind28 Şub 2026·17 dk okumaTailwind CSS v4: Gerçekte Ne Değişti ve Geçiş Yapmalı mısınCSS-first yapılandırma, @layer entegrasyonu, yerleşik container query'ler, yeni motor performansı, kırıcı değişiklikler ve v3'ten v4'e dürüst geçiş deneyimim.cssweb-developmentfrontendDevamını Oku Tailwind CSS v4: Gerçekte Ne Değişti ve Geçiş Yapmalı mısın
networking27 Şub 2026·3 dk okumaWHOIS Lookup Guide for Domain ResearchUse WHOIS lookup for domain research, ownership clues, expiration checks, vendor review, and launch planning without overreading the data.researchsecurityDevamını Oku WHOIS Lookup Guide for Domain Research
css27 Şub 2026·14 dk okumaCSS Flexbox vs Grid — When to Use Which (With Examples)Understand the difference between CSS Flexbox and Grid with side-by-side examples. Learn when to use each layout system for responsive web design.frontendweb-developmentDevamını Oku CSS Flexbox vs Grid — When to Use Which (With Examples)
video27 Şub 2026·3 dk okumaVideo Editor Guide for Browser-Based WorkflowsEdit videos in the browser with a cleaner workflow for clips, captions, audio, exports, review notes, and platform-ready delivery.content-creationbrowser-toolsworkflowDevamını Oku Video Editor Guide for Browser-Based Workflows
image-tools27 Şub 2026·3 dk okumaGIF to JPG Practical Workflow GuideUse GIF to JPG for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku GIF to JPG Practical Workflow Guide
games27 Şub 2026·3 dk okumaWordle Strategy Guide: Better Starting Words and Smarter GuessesImprove Wordle with better starting words, letter coverage, clue interpretation, duplicate letters, and guess discipline.wordstrategybrainDevamını Oku Wordle Strategy Guide: Better Starting Words and Smarter Guesses
security27 Şub 2026·3 dk okumaHash Generator Guide: Checksums, File Integrity, and Safe VerificationLearn how hashes and checksums help verify files, compare data, detect changes, and avoid common security misunderstandings.encodingdeveloper-toolsprivacyDevamını Oku Hash Generator Guide: Checksums, File Integrity, and Safe Verification
frequency-analysis26 Şub 2026·3 dk okumaFrequency Analysis Practical Workflow GuideUse Frequency Analysis for safe inspection workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developer-toolsinspectionprivacyworkflowDevamını Oku Frequency Analysis Practical Workflow Guide
text-tools26 Şub 2026·3 dk okumaText Diff Practical Workflow GuideUse Text Diff for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.writingeditingproductivityDevamını Oku Text Diff Practical Workflow Guide
api26 Şub 2026·2 dk okumacURL Converter Guide: Turn Terminal Requests Into App CodeConvert cURL commands into Fetch, Axios, Python, and other client snippets while preserving headers, body, auth, and method.curldeveloper-toolsprogrammingdebuggingDevamını Oku cURL Converter Guide: Turn Terminal Requests Into App Code
webp26 Şub 2026·3 dk okumaWebP to JPG Guide for Compatibility WorkflowsConvert WebP images to JPG when compatibility, editing tools, uploads, or legacy workflows require a more widely accepted format.jpgimage-toolscompatibilityDevamını Oku WebP to JPG Guide for Compatibility Workflows
seo26 Şub 2026·3 dk okumaSitemap Generator Guide: Help Search Engines Find Important PagesLearn how XML sitemaps support SEO, which URLs to include, what to exclude, and how to keep sitemaps clean.sitemapweb-developmentdeveloper-toolscontentDevamını Oku Sitemap Generator Guide: Help Search Engines Find Important Pages
text-tools26 Şub 2026·3 dk okumaChar Frequency Practical Workflow GuideUse Char Frequency for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.writingeditingproductivityDevamını Oku Char Frequency Practical Workflow Guide
converter25 Şub 2026·12 dk okumaFree Data Format Converters: JSON, CSV, XML, YAML and MoreConvert between JSON, CSV, XML, YAML, TOML, and more data formats instantly. Free online converters with no signup, no upload — all processing in your browser.data-formatsdeveloper-toolsfree-toolsDevamını Oku Free Data Format Converters: JSON, CSV, XML, YAML and More
image-tools24 Şub 2026·3 dk okumaICO to PNG Practical Workflow GuideUse ICO to PNG for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku ICO to PNG Practical Workflow Guide
image-tools24 Şub 2026·2 dk okumaImage Format Converter Guide for File TypesChoose better image formats for websites, social posts, documents, archives, product photos, and design handoffs.design-workflowweb-imagesDevamını Oku Image Format Converter Guide for File Types
pdf24 Şub 2026·2 dk okumaImage to PDF Guide for Document BundlesTurn images into organized PDF bundles for receipts, forms, worksheets, portfolios, applications, and client packets.document-bundlesfile-organizationproductivityDevamını Oku Image to PDF Guide for Document Bundles
networking24 Şub 2026·3 dk okumaIP Address Info Guide for Network DebuggingUse IP address information to investigate routing, access logs, security alerts, geolocation clues, and network troubleshooting.debuggingsecurityDevamını Oku IP Address Info Guide for Network Debugging
markdown24 Şub 2026·10 dk okumaMarkdown Syntax Guide — Everything You Need to Know in 2026Master Markdown syntax from basics to advanced features. Headings, lists, tables, code blocks, links, and GitHub Flavored Markdown — all with examples.writingdeveloper-toolsdocumentationproductivityDevamını Oku Markdown Syntax Guide — Everything You Need to Know in 2026
games24 Şub 2026·3 dk okumaChess Opening Principles for Beginners: Develop Without MemorizingLearn beginner chess opening principles that help you develop pieces, protect your king, and avoid early mistakes.strategybrainmultiplayerDevamını Oku Chess Opening Principles for Beginners: Develop Without Memorizing
timezone24 Şub 2026·3 dk okumaTimezone Converter Guide for Remote Teams and Global SchedulingPlan meetings, launches, webinars, and handoffs across time zones without confusing teammates or customers.productivityremote-workcalendarconverterDevamını Oku Timezone Converter Guide for Remote Teams and Global Scheduling
encoding24 Şub 2026·3 dk okumaDeflate Decompress Practical Workflow GuideUse Deflate Decompress for developer workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.developerworkflowproductivityonline-toolsDevamını Oku Deflate Decompress Practical Workflow Guide
bun24 Şub 2026·23 dk okumaProduction'da Bun: Neler Çalışıyor, Neler Çalışmıyor ve Neler Beni ŞaşırttıBun'ı runtime, paket yöneticisi, bundler ve test runner olarak kullanmak. Gerçek benchmark'lar, Node.js uyumluluk boşlukları, migration kalıpları ve bugün Bun'ı production'da nerede kullanıyorum.node.jsjavascriptruntimeperformanceDevamını Oku Production'da Bun: Neler Çalışıyor, Neler Çalışmıyor ve Neler Beni Şaşırttı
presentation-maker23 Şub 2026·2 dk okumaPresentation Maker Guide for Client DecksBuild clearer client presentations with a stronger narrative, cleaner slides, better visuals, and a more useful review workflow.client-decksbusiness-communicationdesignDevamını Oku Presentation Maker Guide for Client Decks
pdf23 Şub 2026·3 dk okumaTIFF to PDF Practical Workflow GuideUse TIFF to PDF for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku TIFF to PDF Practical Workflow Guide
games23 Şub 2026·12 dk okumaHow to Solve Sudoku: Tips and Strategies for Every LevelMaster Sudoku with proven strategies from beginner to expert. Learn scanning, elimination, naked pairs, X-Wing, and more techniques to solve any puzzle.strategyDevamını Oku How to Solve Sudoku: Tips and Strategies for Every Level
css23 Şub 2026·3 dk okumaCSS Triangle Generator Practical Workflow GuideUse CSS Triangle Generator for front-end design workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designfrontendworkflowDevamını Oku CSS Triangle Generator Practical Workflow Guide
encoding23 Şub 2026·3 dk okumaPercent Encode Practical Workflow GuideUse Percent Encode for converter workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.converterworkflowproductivityonline-toolsDevamını Oku Percent Encode Practical Workflow Guide
generator23 Şub 2026·3 dk okumaFancy Text Generator Practical Workflow GuideUse Fancy Text Generator for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Fancy Text Generator Practical Workflow Guide
html-minifier23 Şub 2026·3 dk okumaHTML Minifier Practical Workflow GuideUse HTML Minifier for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku HTML Minifier Practical Workflow Guide
image-tools23 Şub 2026·3 dk okumaImage Format Converter Guide for Web PerformanceChoose the right image format for websites, emails, screenshots, product photos, and graphics without sacrificing quality or compatibility.web-performancecompressiondesignDevamını Oku Image Format Converter Guide for Web Performance
svg-optimizer22 Şub 2026·3 dk okumaSVG Optimizer Practical Workflow GuideUse SVG Optimizer for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.image-toolsdesignworkflowmediaDevamını Oku SVG Optimizer Practical Workflow Guide
security22 Şub 2026·2 dk okumaPassword Strength Checker Guide: Understand Weak, Strong, and Reused PasswordsUse password strength checking to understand length, randomness, reuse risk, common patterns, and safer account security habits.passwordprivacyfree-toolsauthenticationDevamını Oku Password Strength Checker Guide: Understand Weak, Strong, and Reused Passwords
tools22 Şub 2026·13 dk okumaHow to Minify CSS, JavaScript & HTML Online Free — Complete GuideLearn how to minify CSS, JavaScript, and HTML files online for free. Reduce file sizes by 30-70%, improve page speed, and boost your Core Web Vitals scores.web-developmentperformanceseoDevamını Oku How to Minify CSS, JavaScript & HTML Online Free — Complete Guide
observability22 Şub 2026·29 dk okumaBuilding an Observability Stack That Actually Helps You Debug at 3 AMThe three pillars are not enough. Here is how to build a full observability stack with OpenTelemetry, structured logging, distributed tracing, and alerting that does not wake you up for nothing — across languages and infrastructure.monitoringloggingtracingdevopsDevamını Oku Building an Observability Stack That Actually Helps You Debug at 3 AM
css21 Şub 2026·3 dk okumaFlexbox Generator Practical Workflow GuideUse Flexbox Generator for front-end design workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designfrontendworkflowDevamını Oku Flexbox Generator Practical Workflow Guide
data-formats21 Şub 2026·3 dk okumaJSON Formatter Guide for Faster API DebuggingUse JSON formatting to inspect API responses, logs, webhooks, configs, and fixtures without missing nested fields or broken structure.apideveloper-toolsproductivityDevamını Oku JSON Formatter Guide for Faster API Debugging
pdf20 Şub 2026·3 dk okumaPDF to CSV Practical Workflow GuideUse PDF to CSV for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF to CSV Practical Workflow Guide
discounts20 Şub 2026·3 dk okumaDiscount Calculator Guide for Shopping and PricingCalculate discounts, final prices, stacked offers, and savings more clearly for shopping decisions, promotions, and pricing reviews.pricingshoppingcalculatorDevamını Oku Discount Calculator Guide for Shopping and Pricing
css20 Şub 2026·3 dk okumaCSS Grid Generator Guide for Layout PrototypingPrototype responsive CSS Grid layouts faster by planning tracks, gaps, placement, and breakpoints before moving into production code.frontendlayoutweb-designDevamını Oku CSS Grid Generator Guide for Layout Prototyping
data-formats20 Şub 2026·2 dk okumaJSON to CSV Guide for Report ExportsConvert JSON into CSV for spreadsheets, reports, audits, exports, support reviews, and data handoffs.report-exportsspreadsheetsconverterDevamını Oku JSON to CSV Guide for Report Exports
text-tools19 Şub 2026·3 dk okumaSyllable Counter Practical Workflow GuideUse Syllable Counter for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.writingeditingproductivityDevamını Oku Syllable Counter Practical Workflow Guide
code-to-image19 Şub 2026·3 dk okumaCode to Image Practical Workflow GuideUse Code to Image for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.image-toolsdesignworkflowmediaDevamını Oku Code to Image Practical Workflow Guide
text-tools19 Şub 2026·3 dk okumaWhitespace Remover Practical Workflow GuideUse Whitespace Remover for front-end design workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.cssdesignfrontendworkflowDevamını Oku Whitespace Remover Practical Workflow Guide
cooking19 Şub 2026·3 dk okumaCooking Converter Guide for Recipe ScalingConvert cups, grams, tablespoons, ounces, temperatures, and serving sizes more confidently when scaling recipes for real kitchens.recipe-scalingconvertercalculatorDevamını Oku Cooking Converter Guide for Recipe Scaling
image-tools19 Şub 2026·3 dk okumaQR Art Generator Guide for Branded CodesCreate branded QR codes for posters, packaging, events, and campaigns without sacrificing scan reliability or destination clarity.qr-codesbrandingmarketingDevamını Oku QR Art Generator Guide for Branded Codes
reading-time19 Şub 2026·3 dk okumaReading Time Calculator Guide for Content PlanningEstimate reading time for articles, documentation, lessons, newsletters, and scripts so content expectations stay realistic.content-planningwritingproductivityDevamını Oku Reading Time Calculator Guide for Content Planning
data-formats19 Şub 2026·16 dk okumaJSON Formatter and Validator — How to Pretty Print JSON OnlineFormat, validate, and pretty print JSON data instantly in your browser. Learn JSON syntax rules, common errors, and tips for working with JSON APIs.developer-toolsfree-toolsapiweb-developmentDevamını Oku JSON Formatter and Validator — How to Pretty Print JSON Online
writing19 Şub 2026·3 dk okumaRhyme Finder Practical Workflow GuideUse Rhyme Finder for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolseditingproductivityDevamını Oku Rhyme Finder Practical Workflow Guide
image-tools18 Şub 2026·3 dk okumaCollage Maker Practical Workflow GuideUse Collage Maker for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku Collage Maker Practical Workflow Guide
writing18 Şub 2026·3 dk okumaGrammar Checker Editing Workflow: Improve Writing Without Losing VoiceUse a grammar checker as part of a thoughtful editing workflow for articles, resumes, emails, docs, and marketing copy.textproductivityfree-toolsDevamını Oku Grammar Checker Editing Workflow: Improve Writing Without Losing Voice
image-tools18 Şub 2026·15 dk okumaWebP Image Format: Why You Should Convert Your Images and How to Do It FreeWebP reduces image size by 25-35% vs JPEG with identical quality. Here's why it matters for web performance — and how to convert your entire image library for free.webpperformanceconverterweb-developmentDevamını Oku WebP Image Format: Why You Should Convert Your Images and How to Do It Free
image-tools18 Şub 2026·3 dk okumaWebP to PNG Guide for Transparent AssetsConvert WebP images to PNG for transparent graphics, editing, documentation, design handoff, and platform compatibility.transparent-assetsdesign-workflowDevamını Oku WebP to PNG Guide for Transparent Assets
generator18 Şub 2026·4 dk okumaRandom Team Generator Guide for Fair Group AssignmentsCreate fair random teams for classrooms, workshops, games, and workplace activities while respecting constraints and avoiding confusion.collaborationeducationfacilitationDevamını Oku Random Team Generator Guide for Fair Group Assignments
pdf17 Şub 2026·3 dk okumaPDF Summarizer Practical Workflow GuideUse PDF Summarizer for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Summarizer Practical Workflow Guide
education17 Şub 2026·12 dk okumaLearn to Code for Free in 2026: Resources, Tools and PlatformsStart your coding journey with the best free resources in 2026. From interactive tutorials and online IDEs to practice tools and learning paths for beginners.programming2026Devamını Oku Learn to Code for Free in 2026: Resources, Tools and Platforms
regex-tester17 Şub 2026·2 dk okumaRegex Tester Guide for Pattern DebuggingTest regular expressions for search, cleanup, validation, parsing, and text workflows without guessing at every match.pattern-debuggingtext-toolsproductivityDevamını Oku Regex Tester Guide for Pattern Debugging
wireframes17 Şub 2026·2 dk okumaWireframe Builder Guide for Product PlanningUse wireframes to plan product screens, user flows, content hierarchy, and stakeholder feedback before investing in polished UI.product-planninguxdesignDevamını Oku Wireframe Builder Guide for Product Planning
encoding17 Şub 2026·3 dk okumaBase64 Encoder and Decoder Guide: What It Does and When to Use ItUnderstand Base64 encoding, decoding, common use cases, limitations, and mistakes developers should avoid.developer-toolsapiprogrammingDevamını Oku Base64 Encoder and Decoder Guide: What It Does and When to Use It
games17 Şub 2026·4 dk okumaBrowser Games for Focus Breaks: How to Reset Without Losing the DayUse short browser games as intentional focus breaks, with practical rules for timing, game choice, and avoiding productivity traps.productivitybrainDevamını Oku Browser Games for Focus Breaks: How to Reset Without Losing the Day
calculator17 Şub 2026·3 dk okumaMatrix Calculator Practical Workflow GuideUse Matrix Calculator for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.mathplanningproductivityDevamını Oku Matrix Calculator Practical Workflow Guide
edge17 Şub 2026·14 dk okumaEdge Fonksiyonları: Ne Oldukları, Ne Zaman Kullanılmalı, Ne Zaman KullanılmamalıEdge runtime, V8 izolatları, soğuk başlatma miti, coğrafi yönlendirme, A/B testi, edge'de kimlik doğrulama ve bazı şeyleri neden Node.js'e geri taşıdım. Edge bilişime dengeli bir bakış.next.jsperformancearchitectureweb-developmentDevamını Oku Edge Fonksiyonları: Ne Oldukları, Ne Zaman Kullanılmalı, Ne Zaman Kullanılmamalı
calculator16 Şub 2026·3 dk okumaAge Calculator Guide for Date-Based PlanningCalculate ages and date differences for milestones, forms, events, school records, anniversaries, and planning tasks.date-planningmilestonesproductivityDevamını Oku Age Calculator Guide for Date-Based Planning
developer-tools16 Şub 2026·13 dk okumaBest Free Online Markdown Editors in 2026: Write, Preview, and Export InstantlyWrite beautiful documentation, README files, blog posts, and notes in Markdown — with live preview, syntax highlighting, and export to HTML/PDF. Free, no signup.writingfree-toolsproductivityonline-toolsDevamını Oku Best Free Online Markdown Editors in 2026: Write, Preview, and Export Instantly
image-tools16 Şub 2026·3 dk okumaPNG to ICO Practical Workflow GuideUse PNG to ICO for visual asset workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.designworkflowmediaDevamını Oku PNG to ICO Practical Workflow Guide
ai16 Şub 2026·2 dk okumaAI Content Detector Guide for Review WorkflowsUse AI content detection as one review signal for writing, moderation, classrooms, editorial checks, and content quality workflows.content-revieweditorial-workflowwritingDevamını Oku AI Content Detector Guide for Review Workflows
education16 Şub 2026·3 dk okumaGrade Calculator Guide for Study Progress PlanningUse a grade calculator to understand current standing, remaining assignments, target scores, and study priorities without guessing.calculatorDevamını Oku Grade Calculator Guide for Study Progress Planning
cover-letters16 Şub 2026·3 dk okumaCover Letter Generator Guide for Tailored ApplicationsCreate cover letters that connect your experience to the role without sounding generic, inflated, or disconnected from the resume.job-searchcareerswritingDevamını Oku Cover Letter Generator Guide for Tailored Applications
css16 Şub 2026·2 dk okumaCSS Gradient Generator Guide: Use Gradients Without Making UI NoisyCreate better CSS gradients for buttons, backgrounds, cards, overlays, and hero sections while keeping readability and performance in mind.designweb-developmentgeneratorcolorDevamını Oku CSS Gradient Generator Guide: Use Gradients Without Making UI Noisy
business-days16 Şub 2026·3 dk okumaBusiness Days Practical Workflow GuideUse Business Days for time planning workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.time-toolsplanningproductivityschedulingDevamını Oku Business Days Practical Workflow Guide
generator15 Şub 2026·3 dk okumaPrivacy Policy Generator Practical Workflow GuideUse Privacy Policy Generator for creation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.creative-workflowproductivityplanningDevamını Oku Privacy Policy Generator Practical Workflow Guide
calculator14 Şub 2026·3 dk okumaEquation Solver Practical Workflow GuideUse Equation Solver for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.mathplanningproductivityDevamını Oku Equation Solver Practical Workflow Guide
encoding14 Şub 2026·3 dk okumabcrypt Hash Practical Workflow GuideUse bcrypt Hash for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku bcrypt Hash Practical Workflow Guide
social-media13 Şub 2026·27 dk okumaBest Free Hashtag Generators in 2026: Get More Reach on Instagram, TikTok, and XThe right hashtags can 10x your reach. These free hashtag generators find trending, niche, and optimized tags for Instagram, TikTok, X, LinkedIn, and YouTube.free-toolsmarketingcontent-creationonline-toolsDevamını Oku Best Free Hashtag Generators in 2026: Get More Reach on Instagram, TikTok, and X
schema-markup13 Şub 2026·3 dk okumaSchema Markup Generator Guide for Structured DataUse schema markup to describe articles, tools, products, FAQs, events, and organizations with cleaner structured data for search systems.structured-dataseowebsitesDevamını Oku Schema Markup Generator Guide for Structured Data
developer-tools13 Şub 2026·11 dk okumaFree Online Code Editor: Write, Run & Share Code in 53 RuntimesA free browser-based code editor supporting 53 runtimes. Syntax highlighting, 10 themes, 45 commands, auto-completion, and instant execution.programmingeducationDevamını Oku Free Online Code Editor: Write, Run & Share Code in 53 Runtimes
pdf13 Şub 2026·3 dk okumaPDF to HTML Practical Workflow GuideUse PDF to HTML for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF to HTML Practical Workflow Guide
invoice13 Şub 2026·2 dk okumaInvoice Generator Guide for Small Businesses and FreelancersCreate clearer invoices with the right fields, payment terms, line items, taxes, notes, and file naming habits.businessfinancegeneratorproductivityDevamını Oku Invoice Generator Guide for Small Businesses and Freelancers
image-tools13 Şub 2026·3 dk okumaMeme Generator Guide for Brand and Social PostsCreate sharper memes for social media, community posts, launches, and internal updates without weakening your brand voice.social-mediabrand-voicecontent-creationDevamını Oku Meme Generator Guide for Brand and Social Posts
pdf13 Şub 2026·3 dk okumaPDF Fill Forms Practical Workflow GuideUse PDF Fill Forms for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Fill Forms Practical Workflow Guide
encoding13 Şub 2026·3 dk okumaGzip Compress Practical Workflow GuideUse Gzip Compress for file compression workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.compressiondeveloper-toolsfile-toolsworkflowDevamını Oku Gzip Compress Practical Workflow Guide
encoding13 Şub 2026·3 dk okumaOctal Text Practical Workflow GuideUse Octal Text for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Octal Text Practical Workflow Guide
converter12 Şub 2026·19 dk okumaThe Ultimate Guide to Online Unit Converters (Beyond Google's Basic Math)Google converts kg to lbs. But for color spaces, data formats, encoding schemes, and time zones — you need real converter tools. Here's the complete guide.free-toolsdeveloper-toolsproductivityonline-toolsDevamını Oku The Ultimate Guide to Online Unit Converters (Beyond Google's Basic Math)
data-formats12 Şub 2026·3 dk okumaJSON Schema Generator Practical Workflow GuideUse JSON Schema Generator for data cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.datadeveloper-toolsconverterproductivityDevamını Oku JSON Schema Generator Practical Workflow Guide
image-tools12 Şub 2026·3 dk okumaImage Color Extractor Guide for Brand PalettesExtract colors from images, product photos, mood boards, and campaign visuals to build palettes that still work in real interfaces.brandingcolorvisual-contentDevamını Oku Image Color Extractor Guide for Brand Palettes
pdf12 Şub 2026·3 dk okumaPDF Remove Pages Practical Workflow GuideUse PDF Remove Pages for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Remove Pages Practical Workflow Guide
calculator12 Şub 2026·2 dk okumaScientific Calculator Guide for Student WorkflowsUse a scientific calculator more effectively for homework, labs, test prep, formulas, estimates, and multi-step math checks.educationmathDevamını Oku Scientific Calculator Guide for Student Workflows
pdf11 Şub 2026·3 dk okumaPDF Bates Numbering Practical Workflow GuideUse PDF Bates Numbering for document workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.documentsworkflowproductivityDevamını Oku PDF Bates Numbering Practical Workflow Guide
generator11 Şub 2026·3 dk okumaFlip Text Generator Practical Workflow GuideUse Flip Text Generator for text styling workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Flip Text Generator Practical Workflow Guide
color11 Şub 2026·3 dk okumaColor Picker Guide for UI Design DecisionsUse a color picker to choose, inspect, and document interface colors with better consistency across design files, CSS, and brand systems.ui-designdesign-systemsfrontendDevamını Oku Color Picker Guide for UI Design Decisions
hashtags11 Şub 2026·3 dk okumaHashtag Generator Guide for Better Social DiscoveryChoose hashtags for social posts with a balanced workflow that improves discovery without making captions look spammy or unfocused.social-mediacontent-marketingdiscoveryDevamını Oku Hashtag Generator Guide for Better Social Discovery
calculator11 Şub 2026·2 dk okumaBudget Calculator Guide: Build a Monthly Plan You Can Actually FollowUse a budget calculator to plan income, fixed costs, variable spending, savings, debt payoff, and realistic monthly habits.financebudgetproductivityplanningDevamını Oku Budget Calculator Guide: Build a Monthly Plan You Can Actually Follow
node.js11 Şub 2026·28 dk okumaNode.js'de Gözlemlenebilirlik: Karmaşıklık Olmadan Loglar, Metrikler ve İzlerPino ile yapılandırılmış loglama, Prometheus ile metrikler, OpenTelemetry ile dağıtık izleme. Node.js üretim uygulamaları için kullandığım gözlemlenebilirlik yığını, sıfırdan tam görünürlüğe.observabilitydevopsmonitoringbackendDevamını Oku Node.js'de Gözlemlenebilirlik: Karmaşıklık Olmadan Loglar, Metrikler ve İzler
pdf10 Şub 2026·11 dk okumaFree PDF Tools Online: Edit, Convert, Merge and MoreAccess 56+ free PDF tools online. Edit, merge, split, convert, compress, and sign PDFs directly in your browser. No signup or software installation needed.free-toolsproductivityonline-toolsDevamını Oku Free PDF Tools Online: Edit, Convert, Merge and More
xml-formatter10 Şub 2026·2 dk okumaXML Formatter Guide for Readable DataFormat XML for feeds, exports, configuration files, documentation, integration review, and cleaner troubleshooting.readable-datadata-cleanupdeveloper-toolsDevamını Oku XML Formatter Guide for Readable Data
deno10 Şub 2026·26 dk okumaDeno 2 in Practice: Node Compatibility, JSR, and Whether It's Finally ReadyDeno 2 bet everything on Node.js compatibility and the new JSR registry. After migrating a real project, here's what works, what's still rough, and whether Deno finally has a path to mainstream adoption.javascripttypescriptruntimenode.jsDevamını Oku Deno 2 in Practice: Node Compatibility, JSR, and Whether It's Finally Ready
pdf10 Şub 2026·3 dk okumaPDF Metadata Cleanup Guide for Privacy ReviewsInspect and clean PDF metadata before sharing files so titles, authors, software names, dates, and hidden context do not surprise you.privacydocumentsfile-cleanupDevamını Oku PDF Metadata Cleanup Guide for Privacy Reviews
ocr9 Şub 2026·2 dk okumaImage to Text OCR: Extract Text From Receipts, Notes, and ScreenshotsUse image-to-text OCR to extract text from photos, receipts, screenshots, forms, and notes with better accuracy.image-toolstextproductivityfree-toolsDevamını Oku Image to Text OCR: Extract Text From Receipts, Notes, and Screenshots
calculator9 Şub 2026·3 dk okumaTime Calculator Guide for Timesheets and Work BlocksUse time calculations to total work sessions, plan blocks, compare durations, and reduce timesheet mistakes in daily workflows.timesheetsproductivityplanningDevamını Oku Time Calculator Guide for Timesheets and Work Blocks
developer-tools9 Şub 2026·17 dk okumaHow to Convert JSON to CSV (And Back) — The Developer's Complete GuideJSON and CSV are the two most common data formats, but converting between them is surprisingly tricky. Here's how to handle nested objects, arrays, and edge cases.converterdata-formatsdataDevamını Oku How to Convert JSON to CSV (And Back) — The Developer's Complete Guide
generator9 Şub 2026·2 dk okumaMock Data Generator Guide: Test Interfaces With Realistic DataCreate better mock data for UI states, APIs, demos, tests, and prototypes without leaking real customer information.testingdeveloper-toolsdesignapiDevamını Oku Mock Data Generator Guide: Test Interfaces With Realistic Data
encoding9 Şub 2026·3 dk okumaFile Checksum Practical Workflow GuideUse File Checksum for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku File Checksum Practical Workflow Guide
character-diff9 Şub 2026·3 dk okumaCharacter Diff Practical Workflow GuideUse Character Diff for writing and text cleanup workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.text-toolswritingeditingproductivityDevamını Oku Character Diff Practical Workflow Guide
kanban9 Şub 2026·4 dk okumaKanban Board Workflow Guide for Focused Team ExecutionBuild a Kanban workflow that limits work in progress, clarifies ownership, reveals bottlenecks, and helps teams finish more of what matters.productivityproject-managementteamworkDevamını Oku Kanban Board Workflow Guide for Focused Team Execution
news7 Şub 2026·17 dk okumaHow I Read World News Without Algorithms Deciding What I SeeSocial media algorithms show you what gets clicks, not what matters. Here's how I built a news reading habit using RSS, multi-source aggregation, and zero algorithmic filtering.privacyproductivityrssmedia-literacyDevamını Oku How I Read World News Without Algorithms Deciding What I See
image-tools7 Şub 2026·24 dk okumaBest Free Online Photo Editors in 2026: No Download, No Signup, No WatermarkPhotoshop costs $23/month. These browser-based photo editors offer layers, filters, AI tools, and batch editing — completely free, no account required.free-toolsdesignonline-toolscreativityDevamını Oku Best Free Online Photo Editors in 2026: No Download, No Signup, No Watermark
typescript7 Şub 2026·3 dk okumaJSON to TypeScript Guide for Safer API TypesGenerate TypeScript interfaces from JSON examples, then refine them into safer API models, fixtures, and frontend contracts.data-formatsapideveloper-toolsDevamını Oku JSON to TypeScript Guide for Safer API Types
number-format7 Şub 2026·3 dk okumaNumber Format Practical Workflow GuideUse Number Format for calculation workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.calculatormathplanningproductivityDevamını Oku Number Format Practical Workflow Guide
graphql6 Şub 2026·2 dk okumaGraphQL Formatter Guide for Query ReviewFormat GraphQL queries, mutations, and fragments so API reviews, debugging, documentation, and frontend collaboration stay clearer.apideveloper-toolscode-reviewDevamını Oku GraphQL Formatter Guide for Query Review
whatsapp-links6 Şub 2026·3 dk okumaWhatsApp Link Generator Guide for Customer ContactCreate WhatsApp links for support, sales, bookings, and campaigns with clearer prefilled messages and safer customer handoffs.customer-contactsupportmarketingDevamını Oku WhatsApp Link Generator Guide for Customer Contact
text-tools5 Şub 2026·3 dk okumaText Encryption Practical Workflow GuideUse Text Encryption for defensive security workflow tasks with clean inputs, careful review, privacy-aware handling, and a repeatable process.securitydeveloper-toolsverificationprivacyDevamını Oku Text Encryption Practical Workflow Guide
pdf5 Şub 2026·3 dk okumaMerge PDF Files Without Losing Page Order: A Practical ChecklistLearn how to merge PDF files cleanly, preserve page order, handle mixed document types, and avoid common PDF combining mistakes.documentsproductivityfree-toolsworkflowDevamını Oku Merge PDF Files Without Losing Page Order: A Practical Checklist
sql5 Şub 2026·12 dk okumaSQL Window Functions: The Feature That Changed How I Write Every QueryWindow functions are the single most underused SQL feature. Running totals, rankings, moving averages, gap analysis, and session detection — all without subqueries. Real examples from production databases.postgresqldatabaseperformancebackendDevamını Oku SQL Window Functions: The Feature That Changed How I Write Every Query
color5 Şub 2026·4 dk okumaColor Contrast Checker Guide: Design Text People Can Actually ReadLearn how color contrast affects accessibility, readability, UI quality, and practical design decisions for web pages and apps.accessibilitydesignweb-developmentfree-toolsDevamını Oku Color Contrast Checker Guide: Design Text People Can Actually Read
encoding4 Şub 2026·8 dk okumaBase64 Encoding and Decoding Explained with ExamplesLearn what Base64 encoding is, how it works, and when to use it. Includes practical examples and a free online Base64 encoder/decoder tool.developer-toolseducationDevamını Oku Base64 Encoding and Decoding Explained with Examples
text-tools3 Şub 2026·11 dk okumaFree Online Text Tools: Transform, Convert & Analyze Text Instantly53 free online text tools for every need. Case converters, word counters, text formatters, encoders, Lorem Ipsum generators, and more — all instant and free.productivityfree-toolswritingDevamını Oku Free Online Text Tools: Transform, Convert & Analyze Text Instantly
turborepo3 Şub 2026·20 dk okumaTurborepo Monorepo'ları: Gerçekten Ölçeklenen KurulumBirden fazla uygulamanın paketleri paylaştığı Turborepo monorepo'larını nasıl yapılandırıyorum. Workspace yapılandırması, pipeline önbelleği, paylaşılan TypeScript config'leri ve ilk ayda yaptığım hatalar.monorepotypescriptarchitecturedeveloper-toolsDevamını Oku Turborepo Monorepo'ları: Gerçekten Ölçeklenen Kurulum
regex2 Şub 2026·7 dk okumaRegex Cheat Sheet 2026: Regular Expressions Made SimpleMaster regular expressions with this comprehensive cheat sheet. Learn regex patterns, syntax, and real-world examples with a free online regex tester.developer-toolseducationcheat-sheetDevamını Oku Regex Cheat Sheet 2026: Regular Expressions Made Simple
security1 Şub 2026·16 dk okumaHow to Create Strong Passwords — A Complete Security Guide for 2026Learn how to create unbreakable passwords, use password managers, and protect your accounts from hackers. Free password generator and strength checker included.passwordprivacyonline-safetyfree-toolsDevamını Oku How to Create Strong Passwords — A Complete Security Guide for 2026
games1 Şub 2026·10 dk okumaTop 25 Free Browser Games You Can Play Right Now — No Download RequiredPlay the best free browser games instantly — no download, no signup. Puzzle, strategy, arcade, word games and even multiplayer FPS, all in your browser.entertainmentDevamını Oku Top 25 Free Browser Games You Can Play Right Now — No Download Required
security30 Oca 2026·22 dk okumaPassword Security in 2026: Why Most Password Advice Is Outdated8 characters with a special symbol hasn't been secure for years. Here's what actually works — passphrase generation, entropy math, and the tools that help.privacypasswordfree-toolsonline-toolsDevamını Oku Password Security in 2026: Why Most Password Advice Is Outdated
website-monitoring29 Oca 2026·27 dk okumaHow to Check If a Website Is Down: Free Tools and Methods That Actually WorkIs it just you, or is the website actually down? Here's how to check any website's status instantly — plus how to monitor services and get alerts when they go offline.free-toolstroubleshootinginternetonline-toolsDevamını Oku How to Check If a Website Is Down: Free Tools and Methods That Actually Work
serverless28 Oca 2026·32 dk okumaServerless Beyond the Hype: Patterns, Anti-Patterns, and the $20K Monthly BillServerless isn't just Lambda functions. Event-driven architectures, fan-out patterns, saga orchestration, cold starts, vendor lock-in, and the cost surprises that hit when your traffic actually grows.awsarchitecturecloudlambdaDevamını Oku Serverless Beyond the Hype: Patterns, Anti-Patterns, and the $20K Monthly Bill
pdf27 Oca 2026·17 dk okumaHow to Convert PDF to Word for Free (Without Uploading Your Files Anywhere)Every 'free' PDF to Word converter wants to upload your file to their server. Here's how modern browser tech lets you convert locally — no uploads, no limits, no accounts.converterfree-toolsprivacyproductivityDevamını Oku How to Convert PDF to Word for Free (Without Uploading Your Files Anywhere)
converter26 Oca 2026·24 dk okumaHow to Convert Video to GIF for Free: Best Tools and Tips for 2026Turn any video clip into a perfect GIF — trim, resize, optimize file size, and share. Free browser-based tools that work on any device without software.free-toolssocial-mediaonline-toolsgifDevamını Oku How to Convert Video to GIF for Free: Best Tools and Tips for 2026
design24 Oca 2026·12 dk okumaFree Color Tools: Palette Generators, Pickers and ConvertersExplore free color tools for designers and developers. Generate palettes, pick colors, convert between formats, check contrast, and find the perfect color scheme.colorcssfree-toolsDevamını Oku Free Color Tools: Palette Generators, Pickers and Converters
news22 Oca 2026·11 dk okumaWorld News Aggregator: Stay Informed with 1000+ Sources in 20 LanguagesAccess real-time world news from 1144 RSS sources across 15 categories, 5 regions, and 20 languages. Interactive 3D globe, custom feeds, and RSS export.world-newsaggregatorinformationDevamını Oku World News Aggregator: Stay Informed with 1000+ Sources in 20 Languages
tools22 Oca 2026·13 dk okumaBest Free Data Visualization Tools Online 2026 — Charts, Dashboards & InfographicsTurn raw data into stunning charts, dashboards, and infographics with these free online tools. No coding required — compare the best data visualization platforms.datadesignproductivityDevamını Oku Best Free Data Visualization Tools Online 2026 — Charts, Dashboards & Infographics
tools21 Oca 2026·12 dk okumaBest Free Email Template Builder Online 2026 — HTML Emails Without CodingBuild professional HTML email templates online for free. Drag-and-drop editors, responsive designs, and no coding required — compare the best email builders.designproductivityDevamını Oku Best Free Email Template Builder Online 2026 — HTML Emails Without Coding
trpc21 Oca 2026·23 dk okumatRPC: Seremoni Olmadan Uçtan Uca Tip GüvenliğitRPC'nin API sözleşme sorununu nasıl ortadan kaldırdığı, Next.js App Router ile çalışması, auth middleware, dosya yükleme ve subscription'lar. Sıfırdan gerçek dünya tRPC kurulumu.typescriptnext.jsapifullstackDevamını Oku tRPC: Seremoni Olmadan Uçtan Uca Tip Güvenliği
accessibility20 Oca 2026·11 dk okumaWeb Accessibility Guide 2026: WCAG Compliance Made SimpleMake your website accessible to everyone. Learn WCAG 2.1 AA compliance, color contrast ratios, keyboard navigation, screen readers, and ARIA best practices.wcagweb-developmenta11yDevamını Oku Web Accessibility Guide 2026: WCAG Compliance Made Simple
webassembly17 Oca 2026·26 dk okumaWebAssembly Beyond the Hype: When It Actually Makes SenseA practical, no-nonsense guide to WebAssembly. Real benchmarks, actual use cases, toolchain comparisons, memory management, WASI, and an honest look at when WASM is worth the complexity — and when it absolutely is not.wasmperformanceweb-developmentrustDevamını Oku WebAssembly Beyond the Hype: When It Actually Makes Sense
monorepo16 Oca 2026·27 dk okumaMonorepos in 2026: Nx, Turborepo, and the Lessons Nobody SharesThe strategic decisions behind monorepo tooling that blog posts skip over. Nx vs Turborepo vs Bazel in practice, remote caching failures, CI pipelines that actually work at scale, and when your monorepo has quietly become a monolith.nxturborepodevopstoolingDevamını Oku Monorepos in 2026: Nx, Turborepo, and the Lessons Nobody Shares
sql16 Oca 2026·11 dk okumaSQL Cheat Sheet 2026: Essential Queries Every Developer NeedsMaster SQL with this comprehensive cheat sheet. Learn essential queries, JOINs, subqueries, window functions, and optimization tips with practical examples.databasedeveloper-toolscheat-sheetDevamını Oku SQL Cheat Sheet 2026: Essential Queries Every Developer Needs
graphql15 Oca 2026·30 dk okumaGraphQL vs REST: After Using Both in Production, Here's What I Actually ThinkNot another 'GraphQL is better' or 'REST is simpler' post. Real production experience with both, including the parts that GraphQL evangelists won't tell you and the REST limitations that actually matter.restapiarchitecturebackendDevamını Oku GraphQL vs REST: After Using Both in Production, Here's What I Actually Think
linux14 Oca 2026·26 dk okumaLinux Internals Every Developer Should Know: Processes, Memory, Networking, and the KernelA deep dive into the Linux internals that matter for application developers: process lifecycle, memory management, networking stack, cgroups, eBPF, and the debugging tools that will save you at 3 AM.devopssystems-programmingnetworkingbackendDevamını Oku Linux Internals Every Developer Should Know: Processes, Memory, Networking, and the Kernel
converter12 Oca 2026·22 dk okumaBest Free Online Unit Converters in 2026: Length, Weight, Temperature, Currency, and MoreConvert anything to anything: metric to imperial, Celsius to Fahrenheit, USD to EUR, bytes to gigabytes, and 200+ more conversions — free, instant, no app required.free-toolseducationonline-toolsproductivityDevamını Oku Best Free Online Unit Converters in 2026: Length, Weight, Temperature, Currency, and More
converter10 Oca 2026·13 dk okumaHow to Convert Between JSON, CSV, XML, and YAML for Free: The Complete Data Format GuideJSON to CSV, CSV to JSON, XML to JSON, YAML to JSON — convert between all major data formats instantly in your browser. Free, no signup, handles large files.developer-toolsfree-toolsdataonline-toolsDevamını Oku How to Convert Between JSON, CSV, XML, and YAML for Free: The Complete Data Format Guide
developer-tools10 Oca 2026·9 dk okumaBest Free Developer Tools in 2026: The Ultimate CollectionDiscover the best free developer tools available in 2026. From JSON formatters to API testers and code playgrounds, explore 557+ free online tools for developers that boost productivity.free-toolsweb-development2026Devamını Oku Best Free Developer Tools in 2026: The Ultimate Collection
games8 Oca 2026·31 dk okuma25 Best Multiplayer Browser Games in 2026: No Download, No Install, Just PlayBoard games, strategy, FPS, word games — all playable in your browser with friends. No downloads, no app stores, no waiting. The best free multiplayer browser games of 2026.multiplayeronline-gamingDevamını Oku 25 Best Multiplayer Browser Games in 2026: No Download, No Install, Just Play
api7 Oca 2026·10 dk okuma500+ Free Public APIs for Your Next Project: The Ultimate Developer DirectoryBrowse 500+ free public APIs organized by category. Weather, finance, AI, social media, maps, and more — find the perfect API for your next project.web-developmentdeveloper-toolsprogrammingDevamını Oku 500+ Free Public APIs for Your Next Project: The Ultimate Developer Directory
seo6 Oca 2026·12 dk okumaFree Website SEO Analyzer & Performance Checker: Audit Your Site in SecondsAnalyze your website's SEO, performance, security, and accessibility for free. Get actionable recommendations with our comprehensive 20+ module site analyzer.web-developmentperformanceanalyticsDevamını Oku Free Website SEO Analyzer & Performance Checker: Audit Your Site in Seconds
testing6 Oca 2026·19 dk okumaVitest Test Rehberi: Sıfırdan Production GüvenineUnit testler, integration testler, Testing Library ile bileşen testleri, mock stratejileri, coverage yapılandırması ve gerçekten daha iyi yazılım üreten test felsefesi.vitesttypescriptreactweb-developmentDevamını Oku Vitest Test Rehberi: Sıfırdan Production Güvenine
image-tools5 Oca 2026·27 dk okumaHow to Resize Images Online for Free: The Complete 2026 GuideResize any image to exact dimensions, compress for web, batch resize for social media — all free, no signup, no watermark. Works on phone and desktop.free-toolsproductivitysocial-mediaonline-toolsDevamını Oku How to Resize Images Online for Free: The Complete 2026 Guide
free-tools3 Oca 2026·16 dk okuma25 Best Free Online Tools Every Developer Needs in 2026Discover the top 25 free online developer tools for 2026 — from code formatters and API testers to JSON validators and image optimizers. All browser-based, no install required.developer-toolsonline-toolsproductivityweb-developmentDevamını Oku 25 Best Free Online Tools Every Developer Needs in 2026
design2 Oca 2026·25 dk okumaHow to Create a Color Palette from Any Image: Free Tools and Design Tips for 2026Extract beautiful color palettes from photos, artwork, and screenshots. Free browser tools that give you hex codes, RGB values, and exportable palettes instantly.free-toolscolorcreativityonline-toolsDevamını Oku How to Create a Color Palette from Any Image: Free Tools and Design Tips for 2026
cron31 Ara 2025·10 dk okumaCron Expression Guide: Schedule Tasks Like a ProMaster cron expressions with this complete guide. Learn cron syntax, common schedules, real-world examples, and use a free cron expression generator.devopsdeveloper-toolseducationDevamını Oku Cron Expression Guide: Schedule Tasks Like a Pro
resume31 Ara 2025·20 dk okumaBest Free Resume Builders Online in 2026: Create a Professional CV Without PayingResume builders charge $25/month for what should be free. Here's how to create a professional, ATS-friendly resume online — no subscription, no watermark, no tricks.free-toolscareerproductivityonline-toolsDevamını Oku Best Free Resume Builders Online in 2026: Create a Professional CV Without Paying
markdown28 Ara 2025·10 dk okumaFree Online Markdown Editor with Live Preview: Write Beautiful DocsWrite and preview Markdown in real-time with our free online editor. Syntax highlighting, export to HTML/PDF, GitHub-flavored Markdown support, and zero setup.developer-toolswritingdocumentationDevamını Oku Free Online Markdown Editor with Live Preview: Write Beautiful Docs
tools28 Ara 2025·13 dk okumaBest Free Mind Map Maker Online 2026 — Brainstorm & Organize Ideas VisuallyCreate mind maps online for free with no downloads required. Compare the best free mind mapping tools for brainstorming, project planning, and visual note-taking.productivitydesignDevamını Oku Best Free Mind Map Maker Online 2026 — Brainstorm & Organize Ideas Visually
downdetector27 Ara 2025·13 dk okumaIs It Down or Just Me? How to Check Website StatusLearn how to quickly check if a website is down for everyone or just you. Monitor 1707+ services with real-time status updates and outage history.website-monitoringtoolstroubleshootingDevamını Oku Is It Down or Just Me? How to Check Website Status
design25 Ara 2025·12 dk okumaFree Color Palette Generator & Color Picker for Web DesignersGenerate beautiful color palettes and pick perfect colors for your designs. Free online color tools with HEX, RGB, HSL support and accessibility contrast checking.colorweb-designfree-toolsDevamını Oku Free Color Palette Generator & Color Picker for Web Designers
design23 Ara 2025·24 dk okumaHow to Create Stunning Infographics for Free in 2026: Tools, Templates, and TipsInfographics get 3x more shares than any other content. Here's how to create professional infographics for free — no design skills needed, no Canva Pro required.free-toolscontent-creationsocial-mediaonline-toolsDevamını Oku How to Create Stunning Infographics for Free in 2026: Tools, Templates, and Tips
tools23 Ara 2025·15 dk okumaBest Free Presentation Maker Online 2026 — Create Slides Without PowerPointCreate professional presentations online for free — no PowerPoint needed. Compare the best free slide makers with templates, animations, and collaboration features.productivitydesignDevamını Oku Best Free Presentation Maker Online 2026 — Create Slides Without PowerPoint
css21 Ara 2025·11 dk okumaFree CSS Generators: Gradients, Shadows, Grids and MoreGenerate CSS code for gradients, shadows, grids, flexbox layouts, animations, and more. Free visual tools that output clean, production-ready CSS.web-developmentgeneratorfrontendDevamını Oku Free CSS Generators: Gradients, Shadows, Grids and More
ai21 Ara 2025·32 dk okumaBest Free AI Image Tools Online in 2026: Edit, Enhance, and Create Without PayingAI can remove backgrounds, upscale photos, enhance quality, and generate images — and you don't need to pay for it. The best free AI image tools that run in your browser.image-toolsfree-toolsonline-toolscreativityDevamını Oku Best Free AI Image Tools Online in 2026: Edit, Enhance, and Create Without Paying
micro-frontends20 Ara 2025·26 dk okumaMicro-Frontends: The Honest Reality After Trying ItWhat actually happens when teams adopt micro-frontends in the real world. Module federation, shared dependencies, routing, styling conflicts, and why the org chart matters more than the architecture.architecturereactmodule-federationfrontendDevamını Oku Micro-Frontends: The Honest Reality After Trying It
developer-tools18 Ara 2025·15 dk okumaCompare Text Online: The Best Free Diff Tools for Code, Documents, and DataWhether it's two config files, contract revisions, or API responses — you need a diff tool. Here are the free browser-based options that handle it all.textproductivityfree-toolsprogrammingDevamını Oku Compare Text Online: The Best Free Diff Tools for Code, Documents, and Data
performance18 Ara 2025·20 dk okuma2026'da Core Web Vitals: Gerçekten Fark Yaratan Ne?Teoriyi unut — gerçek bir Next.js üretim sitesinde LCP'yi 2.5s altına, CLS'yi sıfıra ve INP'yi 200ms altına indirmek için gerçekten ne yaptığımı anlatıyorum. Somut teknikler, belirsiz tavsiyeler değil.web-developmentnext.jsseoDevamını Oku 2026'da Core Web Vitals: Gerçekten Fark Yaratan Ne?
learning16 Ara 2025·17 dk okumaLearn to Code for Free in 2026 — Best Interactive Platforms & ResourcesStart coding for free with the best interactive learning platforms in 2026. From JavaScript to Python — compare resources, learning paths, and hands-on tools.web-developmentprogrammingDevamını Oku Learn to Code for Free in 2026 — Best Interactive Platforms & Resources
pdf16 Ara 2025·26 dk okumaHow to Create a Digital Signature Online for Free: Sign PDFs and Documents InstantlyStop printing, signing, scanning, and emailing. Create your digital signature and sign PDFs directly in your browser — free, legally valid, no account needed.digital-signaturefree-toolsproductivityonline-toolsDevamını Oku How to Create a Digital Signature Online for Free: Sign PDFs and Documents Instantly
developer-tools14 Ara 2025·11 dk okumaBest Free Online Developer Tools Every Developer Needs in 2026Discover the best free online developer tools for 2026. JSON formatters, code editors, API testers, converters, and more — all in your browser, no installation needed.web-developmentproductivityfree-toolsDevamını Oku Best Free Online Developer Tools Every Developer Needs in 2026
image-tools14 Ara 2025·24 dk okumaHow to Add Watermarks to Photos for Free: Protect Your Images OnlineProtect your photos from theft with text or logo watermarks — free, in your browser, with batch support. No Photoshop needed, no watermark on the watermark tool.free-toolsphotographyonline-toolscopyrightDevamını Oku How to Add Watermarks to Photos for Free: Protect Your Images Online
games11 Ara 2025·9 dk okumaBest Free Multiplayer Browser Games to Play With Friends in 2026Play the best free multiplayer browser games with friends. 16 real-time multiplayer games including board games, strategy, and even a 3D FPS — no download needed.social-gamingDevamını Oku Best Free Multiplayer Browser Games to Play With Friends in 2026
ai11 Ara 2025·27 dk okumaBuilding AI Agents That Actually Work: Architecture, Patterns, and Hard Lessons from ProductionThe engineering reality behind AI agents in 2026. Tool orchestration, memory systems, planning loops, guardrails, cost control, and the architecture patterns that separate demo agents from production agents.llmarchitecturetypescriptbackendDevamını Oku Building AI Agents That Actually Work: Architecture, Patterns, and Hard Lessons from Production
privacy9 Ara 2025·30 dk okumaHow to Protect Your Online Privacy in 2026: Free Tools and Practical StepsYour data is being collected, sold, and breached constantly. Here are the free tools and simple habits that actually protect your privacy online — no tech degree needed.securityfree-toolsonline-safetyinternetDevamını Oku How to Protect Your Online Privacy in 2026: Free Tools and Practical Steps
news8 Ara 2025·10 dk okumaWorld News from 1000+ Sources: Your Free News AggregatorStay informed with news from 1144+ RSS sources across 15 categories, 5 regions, and 20 languages. Free world news aggregator with 3D globe visualization.world-newsrssfree-toolsDevamını Oku World News from 1000+ Sources: Your Free News Aggregator
browser7 Ara 2025·26 dk okumaHow Browsers Actually Render Pages: A Deep Dive for Performance ObsessivesFrom HTML bytes to pixels on screen — the complete rendering pipeline explained with the depth that actually helps you write faster code. Hidden classes, compositing layers, reflow triggers, and the real mechanics behind every frame.performancerenderingjavascriptweb-developmentDevamını Oku How Browsers Actually Render Pages: A Deep Dive for Performance Obsessives
tools7 Ara 2025·16 dk okumaBest Free Online Whiteboard Tools 2026 — Collaborate, Draw & BrainstormFind the best free online whiteboard tools for real-time collaboration, brainstorming, and visual planning. No downloads needed — compare features, limits, and use cases.productivitycollaborationDevamını Oku Best Free Online Whiteboard Tools 2026 — Collaborate, Draw & Brainstorm
generator4 Ara 2025·16 dk okumaFree QR Code Generators That Don't Track You or Watermark Your CodesMost free QR code generators add tracking pixels, watermarks, or expire after 30 days. Here's how to find ones that generate clean, permanent codes client-side.free-toolsqr-codeprivacymarketingDevamını Oku Free QR Code Generators That Don't Track You or Watermark Your Codes
design4 Ara 2025·20 dk okumaFree Color Palette Generators and Tools Every Designer Needs in 2026Color theory meets practical tooling. Generate harmonious palettes, check WCAG contrast, convert between color spaces, and extract colors from images — all free.colorfree-toolsaccessibilitycssDevamını Oku Free Color Palette Generators and Tools Every Designer Needs in 2026
security4 Ara 2025·21 dk okumaAPI Güvenliği En İyi Uygulamaları: Her Projede Çalıştırdığım Kontrol ListesiKimlik doğrulama, yetkilendirme, girdi doğrulama, rate limiting, CORS, secret yönetimi ve OWASP API Top 10. Her production deployment'ından önce kontrol ettiğim şeyler.apibackendnode.jsweb-developmentDevamını Oku API Güvenliği En İyi Uygulamaları: Her Projede Çalıştırdığım Kontrol Listesi
qr-code3 Ara 2025·16 dk okumaHow to Generate QR Codes for Free — Complete Guide With Use CasesCreate QR codes for URLs, WiFi, vCards, and more — completely free. Learn QR code types, best practices, and creative use cases for business and personal use.free-toolsgeneratormarketingonline-toolsDevamını Oku How to Generate QR Codes for Free — Complete Guide With Use Cases
gaming1 Ara 2025·23 dk okumaWordle Strategy Guide: How to Solve It in 3 Tries (Almost) Every TimeThere's a math-optimal Wordle strategy. The best starting word. The elimination logic. Here's everything from information theory applied to a five-letter word game.gamesstrategybrain-trainingDevamını Oku Wordle Strategy Guide: How to Solve It in 3 Tries (Almost) Every Time
api29 Kas 2025·25 dk okumaAPI Versioning Strategies: The Hard Lessons from Running APIs in Production for 8 YearsURL versioning, header versioning, date-based versioning, deprecation policies, schema evolution, and the migration playbook. What actually works when you have real consumers depending on your API.restversioningbackendarchitectureDevamını Oku API Versioning Strategies: The Hard Lessons from Running APIs in Production for 8 Years
web-performance28 Kas 2025·13 dk okumaHow to Speed Up Your Website — 20 Proven Performance Tips for 2026Boost your website speed with 20 actionable performance optimization tips. Improve Core Web Vitals, reduce load times, and rank higher in search results.seocore-web-vitalsfrontendoptimizationDevamını Oku How to Speed Up Your Website — 20 Proven Performance Tips for 2026
games27 Kas 2025·15 dk okuma30 Best Free Browser Games to Play Right Now (No Download Required)Play the best free browser games instantly — no download, no signup. From puzzle and strategy to arcade and multiplayer games, all running directly in your browser.entertainmentDevamını Oku 30 Best Free Browser Games to Play Right Now (No Download Required)
tools25 Kas 2025·14 dk okumaConvert EPUB to PDF Free Online — Plus MOBI, AZW3 & More Ebook FormatsConvert EPUB to PDF, MOBI, and other ebook formats online for free. No software to install — just upload, convert, and download. Preserve formatting and layout.converterproductivityDevamını Oku Convert EPUB to PDF Free Online — Plus MOBI, AZW3 & More Ebook Formats
gaming23 Kas 2025·15 dk okumaHow to Type Faster: Free Typing Games and Tests That Actually Improve Your SpeedThe average person types 40 WPM. With the right practice — gamified, not boring — you can double that in weeks. Here are the free tools and games that work.text-toolsproductivitygamesfree-toolsDevamını Oku How to Type Faster: Free Typing Games and Tests That Actually Improve Your Speed
timestamp23 Kas 2025·10 dk okumaUnix Timestamp and Epoch Converter: Developer GuideConvert Unix timestamps to human-readable dates and vice versa. Learn what epoch time is, how it works, and use free converter tools for instant results.unixdeveloper-toolsconverterDevamını Oku Unix Timestamp and Epoch Converter: Developer Guide
privacy21 Kas 2025·12 dk okumaFree Online Privacy Tools: Protect Your Data in 2026Discover free privacy tools to protect your data online. Password generators, hash tools, encryption utilities, and browser-based tools that never upload your files.securityfree-toolsencryptionDevamını Oku Free Online Privacy Tools: Protect Your Data in 2026
devops21 Kas 2025·12 dk okumaGerçekten Çalışan VPS Kurulumu: Node.js, PM2, Nginx ve Sıfır Kesintili DağıtımÜretimde kullandığım birebir VPS dağıtım kurulumu — Ubuntu güçlendirme, PM2 küme modu, Nginx ters proxy, SSL ve beni hiç yarı yolda bırakmamış bir deploy betiği. Teori yok, sadece işe yarayan şeyler.vpsnginxpm2deploymentinfrastructureDevamını Oku Gerçekten Çalışan VPS Kurulumu: Node.js, PM2, Nginx ve Sıfır Kesintili Dağıtım
business20 Kas 2025·32 dk okumaBest Free Invoice Generators Online in 2026: Create Professional Invoices in MinutesFreshBooks charges $17/month for invoicing. These free online tools let you create, customize, and export professional invoices as PDF — no signup, no subscription.free-toolsinvoicingproductivityonline-toolsDevamını Oku Best Free Invoice Generators Online in 2026: Create Professional Invoices in Minutes
security20 Kas 2025·19 dk okumaHas Your Email Been in a Data Breach? Here's How to Check and What to DoOver 12 billion accounts have been exposed in data breaches. Here's how to check if yours is one of them — and the exact steps to take if it is.privacydata-breachemailonline-toolsDevamını Oku Has Your Email Been in a Data Breach? Here's How to Check and What to Do
calculator18 Kas 2025·36 dk okumaBest Free Online Calculators in 2026: Scientific, Financial, Health, and MoreFrom mortgage payments to BMI, from scientific equations to tip splitting — the best free online calculators that work in your browser without any app download.free-toolsproductivityeducationonline-toolsDevamını Oku Best Free Online Calculators in 2026: Scientific, Financial, Health, and More
tools15 Kas 2025·15 dk okumaBest Free SVG Editor Online 2026 — Edit, Create & Optimize Vector GraphicsDiscover the best free SVG editors you can use directly in your browser — no downloads, no signups. Edit paths, optimize file size, and create scalable vector graphics online.designsvgweb-developmentDevamını Oku Best Free SVG Editor Online 2026 — Edit, Create & Optimize Vector Graphics
games15 Kas 2025·13 dk okumaPlay Chess Online for Free: Tips, Strategies and MorePlay chess online for free against a grandmaster-level AI or challenge friends in real-time multiplayer. Learn chess strategies, openings, and tips for beginners.strategymultiplayerDevamını Oku Play Chess Online for Free: Tips, Strategies and More
pdf13 Kas 2025·30 dk okumaHow to Merge PDF Files for Free: Combine PDFs Online Without SoftwareNeed to combine multiple PDFs into one? Here's how to merge PDF files for free — in your browser, on any device, without installing anything or creating an account.free-toolsproductivitydocument-editingonline-toolsDevamını Oku How to Merge PDF Files for Free: Combine PDFs Online Without Software
security13 Kas 2025·11 dk okumaHow to Create Strong Passwords: Generator, Tips and PracticesLearn how to create unbreakable passwords with a free password generator. Discover password security best practices, common mistakes, and how to stay safe online.passwordprivacyfree-toolsDevamını Oku How to Create Strong Passwords: Generator, Tips and Practices
pdf11 Kas 2025·10 dk okumaFree Online PDF Tools: Convert, Edit, Merge, Split & MoreComplete suite of 56 free online PDF tools. Convert PDF to Word, merge, split, compress, edit, sign, and more — all in your browser, no upload to servers.productivityfree-toolsconverterDevamını Oku Free Online PDF Tools: Convert, Edit, Merge, Split & More
github-actions10 Kas 2025·28 dk okumaGitHub Actions CI/CD: Gerçekten Çalışan Sıfır Kesinti Deploy'larEksiksiz bir GitHub Actions kurulumu: paralel test job'ları, Docker build önbelleği, VPS'e SSH deploy, PM2 reload ile sıfır kesinti, secret yönetimi ve denenmiş workflow kalıpları.cicddevopsdeploymentinfrastructureDevamını Oku GitHub Actions CI/CD: Gerçekten Çalışan Sıfır Kesinti Deploy'lar
tools9 Kas 2025·15 dk okumaHow to Create Wireframes & Mockups Free Online — UI/UX Design Tools 2026Create wireframes, mockups, and prototypes online for free. Compare the best UI/UX design tools that work in your browser — no Figma subscription needed.designweb-developmentDevamını Oku How to Create Wireframes & Mockups Free Online — UI/UX Design Tools 2026
programming8 Kas 2025·17 dk okumaHow to Learn Coding for Free in 2026 — The Ultimate Beginner's RoadmapStart your coding journey for free in 2026. A step-by-step roadmap from HTML/CSS to full-stack development with free resources, projects, and interactive tools.educationweb-developmentfree-toolscareerDevamını Oku How to Learn Coding for Free in 2026 — The Ultimate Beginner's Roadmap
downdetector6 Kas 2025·12 dk okumaIs It Down? Real-Time Website & Service Status Checker for 1707+ ServicesCheck if a website or service is down right now. Real-time status monitoring for 1707+ services including YouTube, Discord, Netflix, AWS, and more.status-checkermonitoringweb-servicesDevamını Oku Is It Down? Real-Time Website & Service Status Checker for 1707+ Services
qr-code5 Kas 2025·12 dk okumaFree QR Code Generator: Create Custom QR Codes Online in SecondsGenerate free custom QR codes for URLs, text, WiFi, contacts, and more. Customize colors, add logos, download in multiple formats — no signup or watermarks.generatorfree-toolsmarketingDevamını Oku Free QR Code Generator: Create Custom QR Codes Online in Seconds
svg3 Kas 2025·10 dk okumaSVG Guide: Create, Optimize, and Convert SVGs for the WebComplete SVG guide for web developers. Learn to create, optimize, animate, and convert SVG graphics with free online tools. Reduce file sizes by up to 80%.web-developmentdesignoptimizationDevamını Oku SVG Guide: Create, Optimize, and Convert SVGs for the Web
tools2 Kas 2025·17 dk okumaBest Free Grammar Checker Online 2026 — Fix Spelling, Punctuation & StyleFind the best free grammar checkers you can use online without signing up. Compare accuracy, features, and privacy of top grammar checking tools in 2026.writingproductivityDevamını Oku Best Free Grammar Checker Online 2026 — Fix Spelling, Punctuation & Style
api2 Kas 2025·15 dk okumaHow to Test REST APIs — A Beginner's Guide to API Testing in 2026Learn how to test REST APIs with practical examples. Understand HTTP methods, status codes, headers, and authentication. Free online API testing tools included.testingweb-developmentdeveloper-toolsDevamını Oku How to Test REST APIs — A Beginner's Guide to API Testing in 2026
privacy30 Eki 2025·14 dk okumaHow to Remove EXIF Metadata from Photos & Files — Protect Your Privacy OnlineLearn how to remove EXIF metadata from photos and files to protect your privacy. Strip GPS location, camera info, and personal data before sharing online.securitytoolsDevamını Oku How to Remove EXIF Metadata from Photos & Files — Protect Your Privacy Online
converter30 Eki 2025·16 dk okumaOnline Unit Converter — Convert Length, Weight, Temperature, and MoreConvert between metric and imperial units instantly. Length, weight, temperature, volume, speed, and data storage — all with formulas and a free online converter.free-toolsonline-toolseducationproductivityDevamını Oku Online Unit Converter — Convert Length, Weight, Temperature, and More
data-formats29 Eki 2025·10 dk okumaHow to Format, Validate, and Work with JSON: Complete GuideLearn how to format, validate, minify, and transform JSON data. Complete guide with examples, common errors, and free online tools to work with JSON.developer-toolsweb-developmenteducationDevamını Oku How to Format, Validate, and Work with JSON: Complete Guide
qr-code27 Eki 2025·12 dk okumaFree QR Code Generator: Create Custom QR Codes InstantlyCreate free custom QR codes for URLs, WiFi, vCards, text, and more. No signup required. Learn QR code best practices and creative use cases.generatorfree-toolsmarketingDevamını Oku Free QR Code Generator: Create Custom QR Codes Instantly
developer-tools27 Eki 2025·8 dk okumaFree Base64, URL & HTML Encoder/Decoder Tools OnlineEncode and decode Base64, URLs, and HTML instantly in your browser. Free developer tools with no data upload — everything processes locally for maximum privacy.encodingweb-developmentconverterDevamını Oku Free Base64, URL & HTML Encoder/Decoder Tools Online
docker27 Eki 2025·12 dk okumaNode.js İçin Docker: Kimsenin Anlatmadığı Production-Ready KurulumMulti-stage build, root dışı kullanıcı, health check, secret yönetimi ve imaj boyutu optimizasyonu. Her Node.js production deployment'ında kullandığım Docker kalıpları.node.jsdevopsdeploymentinfrastructureDevamını Oku Node.js İçin Docker: Kimsenin Anlatmadığı Production-Ready Kurulum
calculator25 Eki 2025·9 dk okumaFree Online Calculators: Math, Finance, Health and MoreAccess free online calculators for math, finance, health, science, and everyday needs. Scientific calculators, BMI, mortgage, percentage, and 50+ more tools.mathfinancefree-toolsDevamını Oku Free Online Calculators: Math, Finance, Health and More
gaming23 Eki 2025·23 dk okumaPlay Chess Online for Free: The 2026 Guide to Browser-Based ChessYou can now play against a grandmaster-level AI entirely in your browser — no downloads, no accounts, no subscriptions. Here's the state of online chess in 2026.gamesstrategymultiplayerDevamını Oku Play Chess Online for Free: The 2026 Guide to Browser-Based Chess
productivity22 Eki 2025·21 dk okumaBest Free Online Flowchart and Diagram Makers in 2026: No Visio, No ProblemMicrosoft Visio costs $280/year. These free browser-based tools let you create flowcharts, mind maps, wireframes, and UML diagrams — no download, no account required.free-toolsdesigndeveloper-toolsonline-toolsDevamını Oku Best Free Online Flowchart and Diagram Makers in 2026: No Visio, No Problem
regex21 Eki 2025·9 dk okumaFree Regex Tester & Tutorial: Master Regular Expressions OnlineTest and debug regular expressions in real-time with our free online regex tester. Syntax highlighting, match explanations, common patterns library, and interactive tutorials.developer-toolsprogrammingeducationDevamını Oku Free Regex Tester & Tutorial: Master Regular Expressions Online
chromebook19 Eki 2025·17 dk okumaChromebook Power User Guide: 40 Browser Tools That Replace Desktop SoftwareChromebooks aren't limited — your expectations are. Here are 40 browser-based tools that turn any Chromebook into a productivity powerhouse.productivityfree-toolsbrowseronline-toolsDevamını Oku Chromebook Power User Guide: 40 Browser Tools That Replace Desktop Software
ocr18 Eki 2025·25 dk okumaHow to Extract Text from Images for Free: OCR Tools That Actually Work in 2026Need to copy text from a photo, screenshot, or scanned document? These free OCR tools extract text from any image instantly — no software, no signup, 100+ languages.free-toolsproductivitytext-toolsonline-toolsDevamını Oku How to Extract Text from Images for Free: OCR Tools That Actually Work in 2026
news16 Eki 2025·33 dk okumaHow to Read World News Without Algorithms in 2026: Break Free from Your Filter BubbleSocial media feeds you outrage. News apps show you what sells ads. Here's how to read real, unfiltered world news from 400+ sources — with no algorithm deciding what you see.media-literacyfree-toolsinternetonline-toolsDevamını Oku How to Read World News Without Algorithms in 2026: Break Free from Your Filter Bubble
writing16 Eki 2025·30 dk okumaBest Free Plagiarism Checkers Online in 2026: Protect Your Work Without PayingTurnitin charges schools thousands. Grammarly Premium costs $30/month. Here are the free plagiarism checkers that actually work — for students, writers, and educators.free-toolseducationtext-toolsonline-toolsDevamını Oku Best Free Plagiarism Checkers Online in 2026: Protect Your Work Without Paying
developer-tools15 Eki 2025·14 dk okumaBase64 Encoding Explained: What It Is, Why It Exists, and How to Use ItBase64 isn't encryption. It's not compression. It's a way to represent binary data as text — and understanding it will save you hours of debugging.encodingprogrammingweb-developmentfree-toolsDevamını Oku Base64 Encoding Explained: What It Is, Why It Exists, and How to Use It
image-tools14 Eki 2025·20 dk okumaHow to Compress Images Without Losing Quality — Free Online MethodsReduce image file size by up to 80% without visible quality loss. Compare PNG, JPEG, WebP, and AVIF compression methods with free online tools.free-toolsweb-performancedesignonline-toolsDevamını Oku How to Compress Images Without Losing Quality — Free Online Methods
postgresql13 Eki 2025·12 dk okumaPostgreSQL Sorgu Optimizasyonu: Yavaştan Milisaniye AltınaÜretim veritabanlarında kullandığım PostgreSQL optimizasyon teknikleri. EXPLAIN ANALYZE, index stratejileri, sorgu yeniden yazımları ve sorgu sürelerini saniyelerden mikrosaniyeye düşüren değişiklikler.databaseperformancebackendDevamını Oku PostgreSQL Sorgu Optimizasyonu: Yavaştan Milisaniye Altına
education12 Eki 2025·11 dk okumaLearn Programming for Free: Interactive Tutorials, Quizzes & Hands-On PracticeStart learning programming for free with 30 interactive modules, 6 categories, 20 widgets, quizzes, achievements, and spaced repetition — no signup required.programmingDevamını Oku Learn Programming for Free: Interactive Tutorials, Quizzes & Hands-On Practice
free-tools11 Eki 2025·17 dk okuma100 Free Online Tools That Replace Expensive Software in 2026Adobe Creative Suite costs $660/year. Microsoft 365 costs $100/year. Here are 100 browser-based alternatives that cost exactly $0 and don't require installation.productivityonline-toolssoftwarealternativesDevamını Oku 100 Free Online Tools That Replace Expensive Software in 2026
markdown9 Eki 2025·8 dk okumaMarkdown Cheat Sheet: Complete Syntax Guide with ExamplesLearn Markdown syntax with this complete cheat sheet. Headings, lists, links, images, tables, code blocks, and advanced formatting with live examples.educationdeveloper-toolswritingDevamını Oku Markdown Cheat Sheet: Complete Syntax Guide with Examples
gaming7 Eki 2025·17 dk okumaThe Best Free Browser Games Worth Playing in 2026Browser games aren't what they were in 2010. Modern WebGL and multiplayer tech deliver desktop-quality gaming — no downloads, no installs, no accounts.gamesfree-toolsweb-developmentmultiplayerDevamını Oku The Best Free Browser Games Worth Playing in 2026
infrastructure7 Eki 2025·7 dk okumaScaling to One Million Users: The Infrastructure Playbook Nobody SharesThe definitive guide to scaling a web application from 0 to 1M+ users. Connection pooling, caching layers, load balancing, background jobs, edge computing, monitoring, and the real war stories that nobody puts in their blog posts.scalingbackendpostgresqldevopsDevamını Oku Scaling to One Million Users: The Infrastructure Playbook Nobody Shares
git5 Eki 2025·10 dk okumaGit Commands Cheat Sheet 2026: Beginner to AdvancedMaster Git with this comprehensive cheat sheet. Essential commands for setup, branching, merging, rebasing, stashing, and advanced workflows with practical examples.developer-toolscheat-sheetversion-controlDevamını Oku Git Commands Cheat Sheet 2026: Beginner to Advanced
debugging3 Eki 2025·54 dk okumaThe Art of Debugging: How Senior Engineers Find Bugs 10x FasterSystematic debugging from first principles. Scientific method, memory leaks, race conditions, production debugging, war stories, and the mental models that separate juniors who flail from seniors who fix.typescriptnode.jsperformancebackendDevamını Oku The Art of Debugging: How Senior Engineers Find Bugs 10x Faster
converter2 Eki 2025·27 dk okumaHow to Convert Speech to Text for Free: Best Online Transcription Tools in 2026Transcribe meetings, lectures, interviews, and voice memos to text — free, in your browser, supporting 100+ languages. No software to install.free-toolsproductivityaccessibilityonline-toolsDevamını Oku How to Convert Speech to Text for Free: Best Online Transcription Tools in 2026
system-design1 Eki 2025·25 dk okumaSystem Design Interview: The Patterns Nobody Teaches YouThe thinking frameworks, back-of-the-envelope math, and architecture patterns that actually matter in system design interviews — from someone who has been on both sides of the table.architecturedistributed-systemsinterviewsbackendDevamını Oku System Design Interview: The Patterns Nobody Teaches You
redis29 Eyl 2025·30 dk okumaÜretimde Gerçekten İşe Yarayan Redis Önbellekleme StratejileriCache-aside, write-through, cache stampede koruması, TTL stratejileri ve invalidasyon kalıpları. Gerçek kod örnekleriyle üretim Node.js uygulamalarında kullandığım Redis desenleri.cachingbackendnode.jsperformanceDevamını Oku Üretimde Gerçekten İşe Yarayan Redis Önbellekleme Stratejileri
database16 Eyl 2025·24 dk okumaVeritabanı Şema Tasarımı: İyi Yaşlanan KalıplarNormalizasyon kuralları, isimlendirme kuralları, soft delete, audit trail, multi-tenancy kalıpları, versiyon stratejileri ve pişman olduğum şema kararları. PostgreSQL odaklı.postgresqlarchitecturebackendsqlDevamını Oku Veritabanı Şema Tasarımı: İyi Yaşlanan Kalıplar
git3 Eyl 2025·10 dk okumaGit İleri Düzey: Her Hafta Saatler Kazandıran İş AkışlarıInteractive rebase, cherry-pick, bisect, worktree, reflog kurtarma ve gerçekten işe yarayan dallanma stratejileri. Her gün kullandığım ama çoğu geliştiricinin bilmediği Git komutları.devopsworkflowdeveloper-toolsDevamını Oku Git İleri Düzey: Her Hafta Saatler Kazandıran İş Akışları
typescript19 Ağu 2025·18 dk okumaTypeScript İleri Seviye Tipler: Conditional, Mapped ve Template Literal BüyüsüTypeScript'in en güçlü tip özelliklerine derinlemesine bakış — conditional type'lar, mapped type'lar, infer anahtar kelimesi ve template literal type'lar. Gerçekten kullanacağın pratik kalıplar.web-developmentjavascriptDevamını Oku TypeScript İleri Seviye Tipler: Conditional, Mapped ve Template Literal Büyüsü
react5 Ağu 2025·26 dk okumaReact Server Components: Zihinsel Modeller, Kalıplar ve TuzaklarBaşlarken keşke var olsaydı dediğim pratik React Server Components rehberi. Zihinsel modeller, gerçek kalıplar, sınır problemi ve sen yapmayasın diye benim yaptığım hatalar.next.jsweb-developmentarchitectureDevamını Oku React Server Components: Zihinsel Modeller, Kalıplar ve Tuzaklar
next.js23 Tem 2025·10 dk okumaNext.js Projelerini Büyük Ölçekte Yapılandırmak: Zor Yoldan ÖğrendiklerimKendi ağırlığı altında çökmeyen Next.js kod tabanlarını organize etme üzerine zor kazanılmış dersler. Özellik tabanlı mimari, route grupları, sunucu/istemci sınırları, barrel dosyası tuzakları ve çalabileceğiniz gerçek bir klasör yapısı.typescriptarchitectureweb-developmentDevamını Oku Next.js Projelerini Büyük Ölçekte Yapılandırmak: Zor Yoldan Öğrendiklerim
general8 Tem 2025·1 dk okumaMerhaba Dünya: Bu Blogu Neden BaşlattımBu blogun hikayesi: neden yazmaya karar verdim, hangi konuları ele alacağım ve bu siteyi sıfırdan nasıl inşa ettim.web-developmentDevamını Oku Merhaba Dünya: Bu Blogu Neden Başlattım